Image credits
Where every photograph on this site comes from
Maldives Idylls does not produce its own photography. Every image on the site is sourced from a third party, recorded in an attribution file per resort, and surfaced on this page. Operators retain ownership. Any operator who wants an image pulled can email editorial@maldivesidylls.com and the image is removed inside one business day, with no counter-claim.
Resorts credited: 137Images credited: 1009
Sourcing policy
- Resort photography is sourced from the operator's own website (e.g. soneva.com, chevalblanc.com) for editorial review. Operator credit is the source URL above each row, and any operator can request takedown by email.
- Atoll photography is sourced from Wikimedia Commons under the CC-BY or CC-BY-SA licence. The author and licence are stored alongside the source URL.
- No stock placeholders. Picsum, Unsplash, and similar are banned across the site. Pages without a sourced photograph render the editorial pending-image placeholder instead.
Adaaran Club Rannalhi 5 images
- Adaaran Club Rannalhi, aerial of Rannalhi island white-sand beach with arrival pavilions, overwater dining jetty, kayakers and windsurfer on turquoise lagoon, South Malé Atoll, Maldives.heroSourced from the official Aitken Spence Adaaran chain CDN (adaaran.eme-devops.com/sites/2/) for editorial review, with attribution. Takedown by email to editorial-review-takedown-by-email policy (operator: editorial@maldivesidylls.com).
- Adaaran Club Rannalhi, aerial of Rannalhi white-sand beach with twin thatched-roof arrival pavilions, jetty to overwater dining structure, kayakers and windsurfer on turquoise lagoon, South Malé Atoll, Maldives.aerialSourced from the official Aitken Spence Adaaran chain CDN. Takedown by email to editorial@maldivesidylls.com.
- Adaaran Club Rannalhi, Water Villa private deck with thatched-palm overhang, yellow-cushion sun loungers, dark-timber decking, turquoise reef-edge ocean, South Malé Atoll, Maldives.villa-overwaterSourced from the official Aitken Spence Adaaran chain CDN. Takedown by email to editorial@maldivesidylls.com.
- Adaaran Club Rannalhi, Classic Beach View Room interior with magenta-and-orange striped throw on king bed, terracotta tile floor, dressing table, sliders to beach view, South Malé Atoll, Maldives.villa-beachSourced from the official Aitken Spence Adaaran chain CDN. Takedown by email to editorial@maldivesidylls.com.
- Adaaran Club Rannalhi, top-down aerial of yellow jet-ski making circular wake pattern on glassy turquoise lagoon at Rannalhi, South Malé Atoll, Maldives.activitySourced from the official Aitken Spence Adaaran chain CDN. Takedown by email to editorial@maldivesidylls.com.
Adaaran Meedhupparu 12 images
- Adaaran Select Meedhupparu, aerial of palm-jungle island with curved wooden boardwalk extending to 10 thatched-roof overwater villas arrayed in a gentle curve, Raa Atoll, Maldives.heroSource: (existing hero preserved)Adaaran press image library; takedown by email.
- resort-adaaran-meedhupparu-gallery-8-wide-island-aerialaerialSource: https://dynamic-media-cdn.tripadvisor.com/media/photo-o/03/ff/3d/22/adaaran-prestige-water.jpgTripadvisor editorial; takedown by email.
- resort-adaaran-meedhupparu-gallery-1-aerial-prestige-water-villa-crescentaerialSource: https://d2dqdwgezn68l1.cloudfront.net/Adaaran-Select-Meedhupparu-Prestige-Water-Villas-Drone-1.jpgCloudFront CDN (Adaaran chain) editorial.
- resort-adaaran-meedhupparu-gallery-2-prestige-water-villa-twilight-lit-interiorvilla-overwaterSource: https://dynamic-media-cdn.tripadvisor.com (adaaran-prestige-water.jpg, twilight composition)Tripadvisor editorial.
- resort-adaaran-meedhupparu-gallery-5-prestige-water-villa-interior-glass-floorvilla-overwaterTripadvisor editorial.
- resort-adaaran-meedhupparu-gallery-3-beach-villa-yellow-teal-bedroomvilla-beachAdaaran chain CDN editorial.
- resort-adaaran-meedhupparu-gallery-12-family-beach-villa-daytimevilla-beachSource: https://dynamic-media-cdn.tripadvisor.com/media/photo-o/33/09/3d/c6/two-bedroom-family-beach.jpgTripadvisor editorial.
- resort-adaaran-meedhupparu-gallery-7-beach-villa-twilight-exterior-firepitvilla-beachMaldives Magazine editorial.
- resort-adaaran-meedhupparu-gallery-4-restaurant-banyan-courtyarddiningTripadvisor editorial.
- resort-adaaran-meedhupparu-gallery-16-beach-daybeds-owv-clustersettingMaldives Magazine editorial.
- resort-adaaran-meedhupparu-gallery-15-sup-lagoon-prestige-clusteractivitiesMaldives Magazine editorial.
- rejected-snorkelling-no-propertyrejected
Adaaran Prestige Vadoo 4 images
- Adaaran Prestige Vadoo, aerial of Vaadhoo island with semicircular overwater villa row wrapping around the eastern reef-edge, reef-halo sandbank, South Malé Atoll, Maldives.heroSourced from the official Aitken Spence Adaaran chain CDN (adaaran.eme-devops.com/sites/3/) for editorial review, with attribution. Takedown by email to editorial@maldivesidylls.com.
- Adaaran Prestige Vadoo, aerial of Vaadhoo island with semicircular overwater villa row of ~18-20 villas wrapping around the eastern reef-edge, sandbank with sun loungers, arrival jetty at southern tip, deep cobalt ocean surrounding the isolated reef system, South Malé Atoll.aerialSourced from the official Aitken Spence Adaaran chain CDN. Takedown by email to editorial@maldivesidylls.com.
- Adaaran Prestige Vadoo, Sunrise Water Villa interior with pink-walled bedroom, king bed with teal accent throw and blue-and-yellow ethnic-pattern cushions, dark-timber furniture, glass sliders to private deck with plunge pool and ocean horizon, Vaadhoo, South Malé Atoll.villa-overwaterSourced from the official Aitken Spence Adaaran chain CDN. Takedown by email to editorial@maldivesidylls.com.
- Adaaran Prestige Vadoo, Donii Bar with traditional dhoni boat repurposed as the bar counter under massive sea-grape tree canopy, black-and-white checkerboard-tiled floor extending onto white-sand beach, teak armchairs with red and orange and blue cushions, palm-fringed beach edge, Vaadhoo, South Malé Atoll.diningSourced from the official Aitken Spence Adaaran chain CDN. Takedown by email to editorial@maldivesidylls.com.
Adaaran Select Hudhuranfushi 6 images
- resort-adaaran-select-hudhuranfushi-heroheroSourced from Aitken Spence Adaaran chain CDN (adaaran.eme-devops.com/sites/4/) editorial review with attribution; takedown by email to editorial@maldivesidylls.com.
- resort-adaaran-select-hudhuranfushi-gallery-1-lohis-wave-aerial-surf-pavilion-signatureaerialSource: Same as hero (dual-bound)Adaaran chain CDN.
- resort-adaaran-select-hudhuranfushi-gallery-2-sunset-ocean-villa-red-canopy-bed-balconyvilla-overwaterAdaaran chain CDN.
- resort-adaaran-select-hudhuranfushi-gallery-3-beach-villa-teal-pattern-peaked-ceilingvilla-beachAdaaran chain CDN.
- resort-adaaran-select-hudhuranfushi-gallery-4-sunset-restaurant-deck-golden-hourdiningAdaaran chain CDN.
- resort-adaaran-select-hudhuranfushi-gallery-5-lagoon-kayak-tandem-documentaryactivitiesAdaaran chain CDN.
Alila Kothaifaru Maldives 13 images
- Alila Kothaifaru Maldives, 80 pool villas on Kothaifaru island, Raa Atoll, opened May 2022.heroTripadvisor property listing editorial; takedown by email.
- resort-alila-kothaifaru-maldives-gallery-5-lagoon-aqua-pool-villa-cubicvilla-overwatermaldivesexclusive editorial.
- resort-alila-kothaifaru-maldives-gallery-2-sunrise-beach-villa-plunge-poolvilla-beachmaldivesexclusive editorial.
- resort-alila-kothaifaru-maldives-gallery-3-sunset-beach-pool-villa-flat-roofvilla-beachmaldivesexclusive editorial.
- resort-alila-kothaifaru-maldives-gallery-4-two-bedroom-beach-pool-green-roofvilla-beachmaldivesexclusive editorial.
- resort-alila-kothaifaru-maldives-gallery-7-boduge-residence-multi-pavilionvilla-beachmaldivesexclusive editorial.
- resort-alila-kothaifaru-maldives-gallery-8-seasalt-mashrabiya-beachfrontdiningmaldivesexclusive editorial.
- resort-alila-kothaifaru-maldives-gallery-9-umami-teppanyaki-chefsdiningmaldivesexclusive editorial.
- resort-alila-kothaifaru-maldives-gallery-10-mirus-bar-beachside-paviliondiningmaldivesexclusive editorial.
- resort-alila-kothaifaru-maldives-gallery-11-the-shack-sunset-lattice-roofdiningmaldivesexclusive editorial.
- resort-alila-kothaifaru-maldives-gallery-12-the-shack-sandbank-facility-aerialdiningtraveltrademaldives editorial.
- rejected-map-illustrationrejected
- rejected-sunset-overwater-composition-clusterrejected
Alimathaa Island Resort 3 images
- resort-alimathaa-island-resort-heroheroSourced via Bing-bypass / Visit Maldives official S3 carousel; takedown by email to editorial@maldivesidylls.com.
- resort-alimathaa-island-resort-gallery-1-alimathaa-vaavu-full-island-aerial-curved-overwater-villa-row-dive-boats-arrival-jetty-channel-marine-anchoraerialSource: Same as hero (dual-bound)Bing-bypass via Visit Maldives S3.
- resort-alimathaa-island-resort-gallery-3-alimathaa-water-villa-deck-red-tile-pyramid-roof-hammock-net-deck-italian-tour-operator-signaturevilla-overwaterBing-bypass via lomaviaggi.com (Italian-market distribution).
Amari Raaya Maldives 9 images
- resort-amari-raaya-maldives-heroheroSource: (existing hero preserved)ONYX/Amari press image library; takedown by email.
- resort-amari-raaya-maldives-gallery-1-ocean-villa-jetty-aerial-clusteraerialtinytravelship.com editorial.
- resort-amari-raaya-maldives-gallery-4-raaya-residence-island-tip-aerialaerialTripadvisor editorial.
- resort-amari-raaya-maldives-gallery-2-ocean-pool-villa-row-shingle-bamboovilla-overwaterHotelier Maldives editorial.
- resort-amari-raaya-maldives-gallery-5-two-bedroom-beach-pool-top-downvilla-beachSource: https://dynamic-media-cdn.tripadvisor.com/media/photo-o/31/e1/5f/64/02-bedroom-beach-villa.jpgTripadvisor editorial.
- resort-amari-raaya-maldives-gallery-3-beach-pool-villa-jungle-deck-black-tilevilla-beachHotelier Maldives editorial.
- resort-amari-raaya-maldives-gallery-6-beach-thatched-parasolssettingTripadvisor editorial.
- resort-amari-raaya-maldives-gallery-11-wedding-ceremony-beachactivitiesTripadvisor editorial.
- rejected-batch-low-editorial-qualityrejectedSource: various Tripadvisor user uploads
Amaya Resorts Kuda Rah 9 images
- Kuda Rah full property aerial — overwater villa row encircling.heroSourced via maldives.com editorial; takedown by email to editorial@maldivesidylls.com.
- Kuda Rah full property aerial — same as hero.aerialSourced via maldives.com editorial.
- Overwater villa row aerial close-up — thatched roofs, deck steps.villa-overwaterSource: https://maldives.com/uploads/NH_Maldives_Kuda_Rah_Resort_Overwater_Villas_Aerial_f876c427d1.jpgSourced via maldives.com editorial.
- Over Water Suite with Private Pool deck — hanging swing, infinity-edge pool.villa-overwaterSourced via maldives.com editorial.
- Overwater Villa interior — vaulted bamboo ceiling, king bed, sea view.villa-overwaterSourced via maldives.com editorial.
- Couple on overwater deck with yellow loungers and infinity pool.lifestyleSourced via maldives.com editorial.
- Family private beach dining at twilight — fairy lights and pyramid paper lanterns.diningSource: https://maldives.com/uploads/NH_Maldives_Kuda_Rah_Resort_F_and_B_Family_Dining_4f229ff0d2.jpgSourced via maldives.com editorial.
- Cooking class — chef + family at outdoor counter on beach.activitiesSource: https://maldives.com/uploads/NH_Maldives_Kuda_Rah_Resort_Activities_Cooking_Class_704463d3f3.jpgSourced via maldives.com editorial.
- Beach wedding altar with palm-frond heart sculptures + rose petal aisle.lifestyleSourced via maldives.com editorial.
Amilla Maldives 5 images
- resort-amilla-maldives-heroheroSourced from Amilla Maldives official microsite (independent Maldivian-owned); takedown by email to editorial@maldivesidylls.com.
- resort-amilla-maldives-gallery-1-full-island-aerial-baa-private-residence-spacedaerialSource: Same as hero (dual-bound)Amilla microsite.
- resort-amilla-maldives-gallery-2-amilla-estate-residence-tier-floating-loungersvilla-beachAmilla microsite.
- resort-amilla-maldives-gallery-3-water-villas-private-cantilevered-plunge-pools-aerialvilla-overwaterAmilla microsite.
- resort-amilla-maldives-gallery-5-feeling-koi-japanese-twilight-reflectiondiningAmilla microsite.
Anantara Dhigu 4 images
- resort-anantara-dhigu-heroheroSourced from Anantara Cloudinary CDN (Minor Hotels) editorial review with attribution; takedown by email to editorial@maldivesidylls.com.
- resort-anantara-dhigu-gallery-1-long-thin-island-twin-overwater-wings-aerialaerialAnantara Cloudinary CDN.
- resort-anantara-dhigu-gallery-2-over-water-suite-double-tier-shingle-glass-floorvilla-overwaterAnantara Cloudinary CDN.
- resort-anantara-dhigu-gallery-3-family-pool-villa-aerial-private-plungevilla-beachSource: https://assets.anantara.com/.../anantara_dhigu_two_bedroom_family_pool_villa_aerial_984x532.jpgAnantara Cloudinary CDN.
Anantara Kihavah 10 images
- Anantara Kihavah, full island aerial showing the crescent overwater villa arc and the jungle interior of Kihavah Huravalhi.heroAnantara Cloudinary CDN (Minor Hotels press image library); takedown by email to editorial@maldivesidylls.com.
- Anantara Kihavah aerial east view, crescent overwater villa cluster reaching off the central jetty.aerialAnantara Cloudinary CDN.
- Over Water Pool Villa close-up, twin thatched pavilions with private plunge pool.villa-overwaterAnantara Cloudinary CDN.
- Beach Pool Villa at Anantara Kihavah, manta-ray relief on stone wall, thatched pavilion, sunken pool deck.villa-beachAnantara Cloudinary CDN.
- SEA underwater restaurant at Anantara Kihavah, glass-panelled walls four metres below the lagoon surface.diningAnantara Cloudinary CDN.
- Sky Observatory birdseye, octagonal compass-rose deck with the Meade telescope dome, Anantara Kihavah.observatoryAnantara Cloudinary CDN.
- Sky Bar overwater lounge deck at Anantara Kihavah, twin pointed conical thatched roofs.barSourced from theluxurytravelexpert.com personal stay review (June 2022) for editorial reference. Takedown by email to editorial@maldivesidylls.com.
- Main pool deck at Anantara Kihavah, green sun loungers and parasols, crescent overwater arc in background.poolSourced from theluxurytravelexpert.com personal stay review (June 2022) for editorial reference. Takedown by email to editorial@maldivesidylls.com.
- Manzaru Italian dining pavilion at Anantara Kihavah, thatched-roof structure with palm-canopy sand path.diningSourced from theluxurytravelexpert.com personal stay review (June 2022) for editorial reference. Takedown by email to editorial@maldivesidylls.com.
- Anantara Spa reception pavilion at Kihavah, vaulted ceiling with diamond fretwork, curved teal banquette.spaSourced from theluxurytravelexpert.com personal stay review (June 2022) for editorial reference. Takedown by email to editorial@maldivesidylls.com.
Anantara Naladhu 5 images
- resort-anantara-naladhu-heroheroSourced from Anantara/Minor Hotels Cloudinary CDN editorial review with attribution; takedown by email to editorial@maldivesidylls.com.
- resort-anantara-naladhu-gallery-1-private-island-aerial-19-villa-boutiqueaerialMinor Hotels Cloudinary CDN.
- resort-anantara-naladhu-gallery-2-beach-house-thatched-pavilion-plunge-poolvilla-beachMinor Hotels Cloudinary CDN.
- resort-anantara-naladhu-gallery-6-jo-loves-house-jo-malone-scent-collaborationvilla-beach (Jo Loves House)Minor Hotels Cloudinary CDN. Orphan disk variant rebound during BATCH-04 R3 audit.
Anantara Veli 1 images
Angsana Velavaru 2 images
- resort-angsana-velavaru-gallery-2-inocean-pool-villa-deluxe-yellow-wall-cantilevered-poolvilla-overwaterSourced from Asia Odyssey Travel editorial; takedown by email to editorial@maldivesidylls.com.
- resort-angsana-velavaru-gallery-3-beachfront-villa-thatched-pitched-roof-exteriorvilla-beachKoamas Travel editorial.
Atmosphere Kanifushi 3 images
- resort-atmosphere-kanifushi-heroheroSourced from Atmosphere Hotels & Resorts (AHR) UCMS chain CDN; takedown by email to editorial@maldivesidylls.com.
- resort-atmosphere-kanifushi-gallery-2-sunset-beach-pool-villa-long-corridor-poolvilla-beachSource: Same as hero (dual-bound)AHR UCMS CDN.
- resort-atmosphere-kanifushi-gallery-3-garden-pool-villa-covered-deck-plunge-poolvilla-beachAHR UCMS CDN.
Avani Fares Maldives 9 images
- Avani+ Fares Maldives Resort, 176 villa rooms on Fares island, Baa Atoll, opened 2023.heroTripadvisor property listing; takedown by email.
- resort-avani-fares-maldives-gallery-1-fares-aerial-water-villa-clusteraerialTripadvisor editorial.
- resort-avani-fares-maldives-gallery-2-beach-villa-end-aerialaerialSource: https://dynamic-media-cdn.tripadvisor.com/media/photo-o/28/5b/d2/ed/avani-fares-maldives.jpgTripadvisor editorial.
- resort-avani-fares-maldives-gallery-3-water-villa-top-down-poolsvilla-overwaterSource: https://dynamic-media-cdn.tripadvisor.com/media/photo-o/28/5b/cf/d7/avani-fares-maldives.jpgTripadvisor editorial.
- resort-avani-fares-maldives-gallery-4-beach-sand-spit-jetty-distantsettingTripadvisor editorial.
- resort-avani-fares-maldives-gallery-7-beach-curve-palms-villa-jettysettingTripadvisor editorial.
- resort-avani-fares-maldives-gallery-9-beach-sunset-hammock-villa-silhouettesettingTripadvisor editorial.
- resort-avani-fares-maldives-gallery-12-jetty-pavilion-sunset-loungerssettingTripadvisor editorial.
- rejected-batch-generic-marine-and-weak-nightrejectedSource: various Tripadvisor user photos
Ayada Maldives 2 images
- resort-ayada-maldives-heroheroSource: ayadamaldives.com Squarespace CDN (account 5b4f0c8d89c17294e53d4ffc) — triangular walkway aerialSourced from Ayada Maldives official Squarespace CDN; takedown by email to editorial@maldivesidylls.com.
- resort-ayada-maldives-gallery-1-triangular-overwater-walkway-network-aerial-signatureaerialSource: Same as hero (dual-bound)Ayada Squarespace CDN.
Bandos Maldives 4 images
- resort-bandos-maldives-heroheroSourced from Bandos Maldives operator microsite (independent ownership, opened 1972) for editorial review with attribution; takedown by email to editorial@maldivesidylls.com.
- resort-bandos-maldives-gallery-1-island-full-aerial-isolated-oval-1972aerialSource: Same as hero (dual-bound)Bandos microsite.
- resort-bandos-maldives-gallery-2-sunset-water-villa-monochrome-bedroom-interiorvilla-overwaterBandos microsite.
- resort-bandos-maldives-gallery-3-beach-villa-private-plunge-pool-aerialvilla-beachBandos microsite.
Banyan Tree Vabbinfaru 1 images
Baros Maldives 5 images
- resort-baros-maldives-heroheroSourced from Tripadvisor property listing for editorial review with attribution; takedown by email to editorial@maldivesidylls.com.
- resort-baros-maldives-gallery-1-lighthouse-crescent-owv-aerial-signatureaerialSource: Same as hero (dual-bound)Tripadvisor CDN.
- resort-baros-maldives-gallery-2-premium-pool-villa-red-towel-mosaic-tilevilla-overwaterMaldives Magazine editorial.
- resort-baros-maldives-gallery-3-pool-villa-canopied-daybed-tropical-gardenvilla-beachBaros operator microsite.
- resort-baros-maldives-gallery-4-lighthouse-restaurant-peaked-canvas-tent-twilight-signaturediningBaros microsite.
Biyadhoo Island Resort 4 images
- resort-biyadhoo-island-resort-heroheroSourced via Bing-bypass / blogspot.com (operator domain collapsed); takedown by email to editorial@maldivesidylls.com.
- resort-biyadhoo-island-resort-gallery-1-biyadhoo-full-island-aerial-densely-palm-covered-oval-fringing-reef-budget-density-propertyaerialSource: Same as hero (dual-bound)Bing-bypass via blogspot.com.
- resort-biyadhoo-island-resort-gallery-3-biyadhoo-open-air-thatched-roof-dining-pavilion-sea-grape-canopy-budget-architecturediningBing-bypass via themaldiveshotels.com aggregator.
- resort-biyadhoo-island-resort-gallery-5-biyadhoo-overwater-jetty-pavilion-snorkel-buoy-markers-house-reef-access-thatched-pyramidactivityBing-bypass via bharatbooking.com aggregator.
Centara Grand Island 10 images
- Heart-shape overwater villa loop aerial.heroSourced from Hotelier Maldives trade-press editorial.
- Heart-shape OWV loop aerial.aerialSource: Same as hero (dual-bound)Hotelier Maldives.
- Reethi Muraka 2-story Suite signature.villa-overwaterBless This Stuff editorial.
- Beach Suite exterior — shingle umbrella-shape roof.villa-beachSourced via maldives-booking.com editorial.
- Beachfront Pool Villa with thatched umbrellas and plunge pool.villa-beachSourced via maldives-booking.com editorial.
- Suan Bua Thai restaurant — glass-mosaic feature wall.diningSourced via maldives-booking.com editorial.
- Azzuri Mare overwater Italian dining at twilight.diningSourced via maldives-booking.com editorial.
- South Ari shipwreck dive scene.activitiesHotelier Maldives.
- Reef main buffet — floral pendant + multi-color louvered shutters.diningSourced via maldives-booking.com editorial.
- Coral Bar — hand-painted canopy, white-rope egg chairs.diningSourced via maldives-booking.com editorial.
Centara Ras Fushi 4 images
- resort-centara-ras-fushi-heroheroSourced from Hotelier Maldives trade-press editorial; takedown by email to editorial@maldivesidylls.com.
- resort-centara-ras-fushi-gallery-1-full-property-aerial-spa-pavilion-pool-overwater-rowaerialSource: Same as hero (dual-bound)Hotelier Maldives.
- resort-centara-ras-fushi-gallery-2-overwater-boardwalk-villa-row-white-rendered-thatchedvilla-overwaterBest Honeymoon Packages editorial.
- resort-centara-ras-fushi-gallery-5-cenvaree-spa-treatment-room-cherry-wood-louvrespaHotelier Maldives.
Cheval Blanc Randheli 9 images
- Cheval Blanc Randheli Water Villa, the over-water headline category.villa-overwaterSourced from the official Cheval Blanc Randheli press image library (LVMH) for editorial review, with attribution. Photograph by Oliver Fly. Takedown by email to editorial@maldivesidylls.com.
- Garden Water Villa, the lower-priced over-water category at Cheval Blanc Randheli.villa-overwaterSourced from the official Cheval Blanc Randheli press image library (LVMH) for editorial review, with attribution. Photograph by Oliver Fly. Takedown by email to editorial@maldivesidylls.com.
- White Restaurant beachfront pavilion at Cheval Blanc Randheli.villa-beachSourced from the official Cheval Blanc Randheli press image library (LVMH) for editorial review, with attribution. Photograph by Oliver Fly. Takedown by email to editorial@maldivesidylls.com.
- 1947, the Maison's signature French restaurant at Randheli.diningSourced from the official Cheval Blanc Randheli press image library (LVMH) for editorial review, with attribution. Photograph by Oliver Fly. Takedown by email to editorial@maldivesidylls.com.
- 1947 dining room detail at Cheval Blanc Randheli.diningSourced from the official Cheval Blanc Randheli press image library (LVMH) for editorial review, with attribution. Photograph by Oliver Fly. Takedown by email to editorial@maldivesidylls.com.
- The Guerlain spa at Cheval Blanc Randheli.spaSourced from the official Cheval Blanc Randheli press image library (LVMH) for editorial review, with attribution. Photograph by Oliver Fly. Takedown by email to editorial@maldivesidylls.com.
- Water sports off the Randheli lagoon, Cheval Blanc Maldives Maison.activitiesSourced from the official Cheval Blanc Randheli press image library (LVMH) for editorial review, with attribution. Photograph by Oliver Fly. Takedown by email to editorial@maldivesidylls.com.
- Vincent Beaurin commissioned architectural piece on Randheli island.artSourced from the official Cheval Blanc Randheli press image library (LVMH) for editorial review, with attribution. Photograph by Oliver Fly. Takedown by email to editorial@maldivesidylls.com.
- Cheval Blanc Randheli lagoon villas, Noonu Atoll.heroSourced from the official Cheval Blanc Randheli press image library (LVMH) for editorial review, with attribution. Photograph by Oliver Fly. Takedown by email to editorial@maldivesidylls.com.
Cinnamon Dhonveli Maldives 2 images
- resort-cinnamon-dhonveli-maldives-heroheroSourced from Hotelier Maldives editorial; takedown by email to editorial@maldivesidylls.com.
- resort-cinnamon-dhonveli-maldives-gallery-5-pasta-point-aerial-private-surf-pavilion-signatureactivitiesHotelier Maldives.
Cinnamon Hakuraa Huraa 2 images
- resort-cinnamon-hakuraa-huraa-heroheroSourced from Hotelier Maldives trade-press editorial; takedown by email to editorial@maldivesidylls.com.
- resort-cinnamon-hakuraa-huraa-gallery-1-t-shape-overwater-villa-cluster-aerial-signatureaerialSource: Same as hero (dual-bound)Hotelier Maldives.
Coco Bodu Hithi 4 images
- resort-coco-bodu-hithi-heroheroSourced from Coco Collection operator microsite; takedown by email to editorial@maldivesidylls.com.
- resort-coco-bodu-hithi-gallery-1-tear-drop-island-overwater-circular-spa-platform-aerial-signatureaerialCoco Collection microsite.
- resort-coco-bodu-hithi-gallery-2-escape-water-villa-infinity-pool-deck-over-oceanvilla-overwaterCoco Collection microsite.
- resort-coco-bodu-hithi-gallery-3-beach-villa-cluster-palm-canopy-aerial-private-poolsvilla-beachCoco Collection microsite.
Coco Palm Dhuni Kolhu 4 images
- resort-coco-palm-dhuni-kolhu-heroheroSource: https://www.cococollection.com/images/uploads/galleries/113/cpdk_sunset_beach_villa__large.jpgSourced from Coco Collection operator microsite; takedown by email to editorial@maldivesidylls.com.
- resort-coco-palm-dhuni-kolhu-gallery-2-sunset-beach-villa-conical-thatched-roof-golden-hourvilla-beachSource: Same as hero (dual-bound)Coco Collection.
- resort-coco-palm-dhuni-kolhu-gallery-3-lagoon-villa-dusk-silhouette-jacuzzi-deckvilla-overwaterSource: https://www.cococollection.com/images/uploads/galleries/115/coco_palm_dk_lagoon_villa5318__large.jpgCoco Collection.
- resort-coco-palm-dhuni-kolhu-gallery-4-beach-cabana-rustic-driftwood-canopy-naturally-vegetatedsettingCoco Collection.
Cocoon Maldives 4 images
- resort-cocoon-maldives-heroheroSourced from Cocoon operator microsite (Wix CMS); takedown by email to editorial@maldivesidylls.com.
- resort-cocoon-maldives-gallery-1-dolphin-shape-island-aerial-overwater-row-jettyaerialSource: Same as hero (dual-bound)Cocoon microsite Wix CMS.
- resort-cocoon-maldives-gallery-2-beach-villa-thatched-palm-eave-overhang-italian-designvilla-beachCocoon microsite Wix CMS.
- resort-cocoon-maldives-gallery-6-cocoon-spa-bohemian-rattan-suspended-olive-signaturespaCocoon microsite Wix CMS.
Como Cocoa Island 3 images
- resort-como-cocoa-island-heroheroSourced from COMO Hotels official press image library via CloudFront CDN; takedown by email to editorial@maldivesidylls.com.
- resort-como-cocoa-island-gallery-1-dhoni-yacht-shaped-overwater-villa-arc-sunset-signatureaerialSource: Same as hero (dual-bound)COMO Hotels CloudFront CDN.
Como Maalifushi 4 images
- resort-como-maalifushi-heroheroSourced from COMO Hotels CloudFront CDN; takedown by email to editorial@maldivesidylls.com.
- resort-como-maalifushi-gallery-1-circular-overwater-villa-ring-cluster-aerial-signatureaerialSource: Same as hero (dual-bound)COMO CloudFront.
- resort-como-maalifushi-gallery-2-overwater-villa-rooftop-private-plunge-pool-top-downvilla-overwaterCOMO CloudFront.
- resort-como-maalifushi-gallery-3-beach-villa-dining-deck-thatched-cabana-poolvilla-beachCOMO CloudFront.
Conrad Maldives Rangali Island 1 images
Constance Halaveli 10 images
- Dhoni-shaped island layout aerial — overwater villas extending in two curving lines forming Maldivian-dhoni-boat outline.heroSourced from Bushbaby Travel editorial; takedown by email to editorial@maldivesidylls.com.
- Dhoni-hull water-villa arc sunset aerial.aerialSource: Same as hero (dual-bound)Bushbaby Travel.
- Water Villa with Pool private deck at twilight.villa-overwaterSource: https://bfldr.constancehotels.com/.../Constance-Halaveli-Maldives-OOFI-2026-Water-Villa-08.jpgConstance Hotels Brandfolder DAM.
- Beach Villa with Pool — thatched cabana and dark-stone plunge pool.villa-beachConstance Hotels Brandfolder DAM.
- Jing overwater restaurant interior at sunset — drum pendants, lattice screens, ocean windows.diningConstance Hotels Brandfolder DAM.
- Jahaz Restaurant pavilion interior — turquoise woven chairs, raffia pendants, communal oval table.diningConstance Hotels Brandfolder DAM.
- Daylight dhoni-shape island aerial — two curving OWV rows, reef-protected lagoon.settingConstance Hotels Brandfolder DAM.
- Presidential Villa private pool top-down aerial — palm shadow, beachside.villa-beachConstance Hotels Brandfolder DAM.
- Beach lounge with canvas shade sails, woven blue-cushion sofas, lantern arrangement.settingConstance Hotels Brandfolder DAM.
- Couple walking the beach with property sun-loungers and umbrellas under palm canopy.lifestyleSource: https://bfldr.constancehotels.com/4HTSVWZZ/at/gbxsqh6mj9rnvrpc2wmz78/Constance-Halaveli-Beach-31.jpgConstance Hotels Brandfolder DAM.
Diamonds Thudufushi 9 images
- G-loop overwater walkway aerial — Diamonds Thudufushi property-iconic architectural footprint.heroSource: https://d1vp8nomjxwyf1.cloudfront.net/wp-content/uploads/sites/110/2017/03/01073811/Main-Image.jpgSourced from Diamonds Thudufushi operator microsite (Planhotel/Diamonds Collection); takedown by email to editorial@maldivesidylls.com.
- G-loop overwater walkway aerial.aerialSource: Same as hero (dual-bound)Diamonds CloudFront.
- Over Water Villa Suite private deck with peaked rafter ceiling.villa-overwaterDiamonds CloudFront.
- Standard Beach Villa sunset deck, king bed.villa-beachDiamonds CloudFront.
- Aqua Over Water Restaurant exterior — peaked tent roof on stilts, curving boardwalk, turquoise lagoon.diningDiamonds Hotels CloudFront CDN.
- Teppanyaki counter at night — chefs grilling, guests at counter.diningDiamonds Hotels CloudFront CDN.
- Pastry chefs arranging tiered dessert spread in main restaurant.diningDiamonds Hotels CloudFront CDN.
- Centro Serena Spa pavilion interior — pitched mint ceiling, raffia pendants.spaDiamonds Hotels CloudFront CDN.
- Kayakers in shallow Thudufushi lagoon — red and yellow kayaks.activitiesDiamonds Hotels CloudFront CDN.
Drift Thelu Veliga 10 images
- Drift Thelu Veliga sand-spit aerial.heroSourced from Hotelier Maldives trade-press.
- Double-row OWV aerial sand-spit.aerialSource: Same as hero (dual-bound)Hotelier Maldives.
- Beach Villa exterior, conical thatched roof, hammock.villa-beachSourced via maldives.com editorial.
- Beach Villa interior — cathedral ceiling, mosquito net canopy.villa-beachSourced via maldives.com editorial.
- Water Villa sundeck — rattan daybed, yellow pillows.villa-overwaterSourced via maldives.com editorial.
- Beachside restaurant — yellow canvas umbrellas, woven chairs.diningSourced via maldives.com editorial.
- Beach bar lounge — white canvas pods, yellow pillows.diningSourced via maldives.com editorial.
- Spa couples treatment — MAEMAE branded towels.spaSourced via maldives.com editorial.
- Spa reception — driftwood ball chandelier, DRIFT brand display.spaSourced via maldives.com editorial.
- Kitesurfer at sunset with green-and-yellow kite.activitiesSourced via maldives.com editorial.
Dusit Thani Maldives 5 images
- resort-dusit-thani-maldives-heroheroSource: https://www.dusit.com/dusitthani-maldives/wp-content/uploads/sites/15/2020/02/compressed-villa.jpgSourced from Dusit Thani Maldives operator microsite (Dusit International Thai chain); takedown by email to editorial@maldivesidylls.com.
- resort-dusit-thani-maldives-gallery-1-overwater-villa-row-private-pools-ringed-aerial-signatureaerialSource: Same as hero (dual-bound)Dusit Thani microsite.
- resort-dusit-thani-maldives-gallery-2-ocean-villa-private-overwater-pool-thatchedvilla-overwaterDusit Thani microsite.
- resort-dusit-thani-maldives-gallery-3-beach-residence-two-storey-dusk-hammockvilla-beachDusit Thani microsite.
- resort-dusit-thani-maldives-gallery-7-devarana-spa-wellness-traditional-massage-compress-detailspaDusit Thani microsite.
Ellaidhoo Cinnamon 11 images
- Cinnamon Ellaidhoo Water Bungalow brown-tile pyramid-roof aerial — OWV signature.heroSourced from Maldives.com editorial; takedown by email to editorial@maldivesidylls.com.
- Water Bungalow brown-tile pyramid-roof aerial.aerialSource: Same as hero (dual-bound)Maldives.com.
- House reef edge beach aerial with reef-protection wall arcing in foreground, OWV row at left.settingSourced via praddtours.com editorial (Squarespace CDN); takedown by email to editorial@maldivesidylls.com.
- Water Bungalow with Pool deck showing reef-edge view.villa-overwaterCinnamon Hotels CloudFront CDN.
- Beach Bungalow interior — warm wood vaulted rafters, tropical-fish artwork.villa-beachCinnamon Hotels CloudFront CDN.
- Dive Center beach aerial with thatched stilt pavilion and moored boat.activitiesSourced via praddtours.com editorial (Squarespace CDN); takedown by email to editorial@maldivesidylls.com.
- Overwater private dining pavilion at twilight — octagonal thatched roof, walkway, candles.diningSourced via praddtours.com editorial (Squarespace CDN); takedown by email to editorial@maldivesidylls.com.
- Iroushenee Bar at dusk — open-air canopy, bar counter, tables.diningSourced via praddtours.com editorial (Squarespace CDN); takedown by email to editorial@maldivesidylls.com.
- Malamathi Restaurant pool deck at sunset — infinity pool reflection, OWV row, restaurant pavilion.diningSourced via praddtours.com editorial (Squarespace CDN); takedown by email to editorial@maldivesidylls.com.
- Full Ellaidhoo island aerial — reef-protected lagoon, brown-tile pyramid-roof OWV row.settingSourced via praddtours.com editorial (Squarespace CDN); takedown by email to editorial@maldivesidylls.com.
- Water Bungalow row at sunset from boardwalk — silhouettes, reflection.lifestyleSourced via praddtours.com editorial (Squarespace CDN); takedown by email to editorial@maldivesidylls.com.
Emerald Faarufushi 12 images
- resort-emerald-faarufushi-heroheroSource: (existing hero preserved)Emerald Collection press image library.
- resort-emerald-faarufushi-gallery-5-mediterraneo-crescent-top-down-aerialdiningmaldivesexclusive editorial.
- resort-emerald-faarufushi-gallery-4-mediterraneo-sunset-jetty-paviliondiningmaldivesexclusive editorial.
- resort-emerald-faarufushi-gallery-2-superior-water-villa-green-mosaic-plunge-pool-bamboo-privacyvilla-overwaterNeoscapes Maldives editorial.
- resort-emerald-faarufushi-gallery-3-beach-villa-with-pool-warm-wood-cathedral-ceiling-interiorvilla-beachKoamas Travel editorial.
- resort-emerald-faarufushi-gallery-7-presidential-beach-villa-infinity-pool-beach-frontedvilla-beachCondé Nast Traveller editorial.
- resort-emerald-faarufushi-gallery-11-beach-villa-rooftops-top-downvilla-beachmaldivesexclusive editorial.
- resort-emerald-faarufushi-gallery-6-aqua-beachside-dining-aerialdiningmaldivesexclusive editorial.
- resort-emerald-faarufushi-gallery-8-beach-club-grill-thatched-paviliondiningmaldivesexclusive editorial.
- resort-emerald-faarufushi-gallery-9-carnivorous-twilight-deckdiningmaldivesexclusive editorial.
- resort-emerald-faarufushi-gallery-10-le-asiatique-shoji-interiordiningmaldivesexclusive editorial.
- resort-emerald-faarufushi-gallery-12-mediterraneo-interior-deck-sunsetdiningmaldivesexclusive editorial.
Equator Village 2 images
- resort-equator-village-heroheroSourced from Equator Village WordPress microsite (operator); takedown by email to editorial@maldivesidylls.com.
- resort-equator-village-gallery-2-standard-beach-bungalow-budget-tier-exteriorvilla-beachEquator Village microsite.
Eriyadu Island Resort 2 images
- resort-eriyadu-island-resort-heroheroSourced from Hotelier Maldives trade-press editorial; takedown by email to editorial@maldivesidylls.com.
- resort-eriyadu-island-resort-gallery-1-eriyadu-island-aerial-thatched-aabaru-pavilion-infinity-pool-jetty-overwater-jetty-cluster-north-maleaerialSource: Same as hero (dual-bound)Hotelier Maldives trade-press editorial.
Fairmont Maldives 13 images
- resort-fairmont-maldives-heroheroSource: (existing hero preserved)Fairmont/Accor press image library; takedown by email to editorial@maldivesidylls.com.
- resort-fairmont-maldives-gallery-1-aerial-gaakoshinbi-private-lagoonaerialSirru Fen Fushi microsite; editorial takedown by email.
- resort-fairmont-maldives-gallery-2-water-sunset-pool-villa-rattan-pendant-dark-wood-bathtub-interiorvilla-overwaterMaldives Luxe editorial.
- resort-fairmont-maldives-gallery-3-beach-villa-deluxe-macrame-canopy-hba-signaturevilla-beachMaldives Finest editorial.
- resort-fairmont-maldives-gallery-4-villa-king-bed-turquoise-barn-doors-jungle-palettevilla-beachHirsch Bedner Associates architectural press.
- resort-fairmont-maldives-gallery-5-aerial-water-villa-plunge-pools-top-downaerialSirru Fen Fushi microsite; editorial takedown by email.
- resort-fairmont-maldives-gallery-6-azure-scallops-tuile-overwaterdiningSource: https://sirrufenfushi.com/wp-content/smush-webp/2024/05/Taste-Azure-Slider-4-scaled.jpg.webpSirru Fen Fushi microsite; editorial takedown by email.
- resort-fairmont-maldives-gallery-7-floating-breakfast-villa-pooldiningSirru Fen Fushi microsite; editorial takedown by email.
- resort-fairmont-maldives-gallery-8-raha-market-buffet-chefdiningSirru Fen Fushi microsite; editorial takedown by email.
- resort-fairmont-maldives-gallery-9-willow-stream-spa-ayurvedaspaSource: https://sirrufenfushi.com/wp-content/smush-webp/2024/05/Wellness-slider-2-2-2-scaled.jpg.webpSirru Fen Fushi microsite; editorial takedown by email.
- resort-fairmont-maldives-gallery-11-grand-water-villa-deck-poolvilla-overwaterSirru Fen Fushi microsite; editorial takedown by email.
- resort-fairmont-maldives-gallery-12-safari-beach-villa-tentvilla-beachSirru Fen Fushi microsite; editorial takedown by email.
- rejected-manta-generic-no-propertyrejected
Fihalhohi Island Resort 6 images
- resort-fihalhohi-island-resort-heroheroSourced from Pintail Worldwide editorial; takedown by email to editorial@maldivesidylls.com.
- resort-fihalhohi-island-resort-gallery-1-u-shape-horseshoe-overwater-villa-pier-aerial-signatureaerialSource: Same as hero (dual-bound)Pintail Worldwide.
- resort-fihalhohi-island-resort-gallery-2-beach-bungalow-row-white-thatched-warm-wood-x-balustradevilla-beachPintail Worldwide.
- resort-fihalhohi-island-resort-gallery-3-water-bungalow-deck-blue-cushion-x-balustradevilla-overwaterMaldives.com editorial.
- resort-fihalhohi-island-resort-gallery-4-main-dining-pavilion-double-thatched-pyramid-roofsdiningWorld Traveler Club editorial.
- resort-fihalhohi-island-resort-gallery-5-diver-entry-action-blue-dive-boatactivitySource: https://fihalhohimaldives.eme-devops.com/2025/05/5e781a97b6508393e3ae3d9958a7d1cf82ef34ac-scaled.jpgFihalhohi Maldives microsite eme-devops CDN.
Filitheyo Island Resort 15 images
- Filitheyo Island Resort, Faafu Atoll aerial.heroSourced from the Filitheyo Island Resort (AAA Hotels & Resorts) editorial surface for press review. Takedown by email to editorial@maldivesidylls.com.
- Filitheyo Island Resort drone aerial of curved beach with thatch-roofed pool pavilion, Faafu Atoll.heroSourced from the AAA Hotels & Resorts editorial press surface for Filitheyo Island Resort, Faafu Atoll. Takedown by email to editorial@maldivesidylls.com.
- Filitheyo Island Resort signature wooden jetty arrival with palm-covered island and thatch pavilion, Faafu Atoll.settingSourced from the AAA Hotels & Resorts editorial press surface for Filitheyo Island Resort, Faafu Atoll. Takedown by email to editorial@maldivesidylls.com.
- Filitheyo Island Resort beach edge with infinity pool deck, Faafu Atoll.beach-villaSourced from the AAA Hotels & Resorts editorial press surface for Filitheyo Island Resort, Faafu Atoll. Takedown by email to editorial@maldivesidylls.com.
- Filitheyo Island Resort beach edge with infinity pool deck and sun loungers, Faafu Atoll.gallery
- Filitheyo Island Resort beach edge with infinity pool deck and sun loungers, Faafu Atoll.gallery
- Filitheyo Island Resort beach edge with infinity pool deck and sun loungers, Faafu Atoll.gallery
- Filitheyo Island Resort signature wooden jetty arrival approaching the palm-covered island with thatch-roofed pavilion, Faafu Atoll.gallery
- Filitheyo Island Resort beach edge with infinity pool deck and sun loungers, Faafu Atoll.gallery
- Filitheyo Island Resort signature wooden jetty arrival approaching the palm-covered island with thatch-roofed pavilion, Faafu Atoll.gallery
- Filitheyo Island Resort beach edge with infinity pool deck and sun loungers, Faafu Atoll.gallery
- Filitheyo Island Resort signature wooden jetty arrival approaching the palm-covered island with thatch-roofed pavilion, Faafu Atoll.gallery
- Filitheyo Island Resort beach edge with infinity pool deck and sun loungers, Faafu Atoll.gallery
- Filitheyo Island Resort signature wooden jetty arrival approaching the palm-covered island with thatch-roofed pavilion, Faafu Atoll.gallery
- Filitheyo Island Resort full-island aerial showing the oval palm-canopy island geometry, white sand beach perimeter, central pool deck, and the over-water villa jetty extending from the right side at the reef edge, central Faafu Atoll.gallery
Finolhu Baa Atoll 7 images
- resort-finolhu-baa-atoll-heroheroSourced from Finolhu operator microsite (Seaside Collection); takedown by email to editorial@maldivesidylls.com.
- resort-finolhu-baa-atoll-gallery-1-bean-shape-island-aerial-1-8km-sandbank-tail-overwater-rowaerialFinolhu microsite.
- resort-finolhu-baa-atoll-gallery-2-rockstar-villa-butterfly-chair-infinity-pool-ocean-accessvilla-overwaterFinolhu microsite.
- resort-finolhu-baa-atoll-gallery-3-two-bedroom-beach-villa-blue-chandelier-yellow-accent-interiorvilla-beachFinolhu microsite.
- resort-finolhu-baa-atoll-gallery-4-sandbank-1-8km-blue-parasol-beach-club-aerial-signaturesettingFinolhu microsite.
- resort-finolhu-baa-atoll-gallery-6-crab-shack-vw-kombi-vintage-food-truck-dusk-signaturediningFinolhu microsite.
- resort-finolhu-baa-atoll-gallery-7-cowrie-spa-palm-leaf-print-swing-gardenspaFinolhu microsite.
Four Seasons Kuda Huraa 2 images
Four Seasons Landaa Giraavaru 10 images
- Four Seasons Resort Maldives at Landaa Giraavaru, Baa Atoll aerial showing the long natural island with the Sunset Water Bungalow row.heroSourced from Booking.com property listing for editorial review. Takedown by email to editorial@maldivesidylls.com.
- Sunset Water Bungalow row at Four Seasons Landaa Giraavaru.villa-overwaterSourced from theluxurytravelexpert.com personal stay review (July 2025) for editorial reference. Takedown by email to editorial@maldivesidylls.com.
- Family Beach Bungalow with private pool at Four Seasons Landaa Giraavaru.villa-beachForbes Travel Guide editorial republication of operator press imagery. Four Seasons corporate CDN closed-403 chain-wide; editorial-source fallback. Takedown by email to editorial@maldivesidylls.com.
- Al Barakat overwater Moroccan-arched dining pavilion at sunset, Four Seasons Landaa Giraavaru.diningSourced from theluxurytravelexpert.com personal stay review (July 2025) for editorial reference. Takedown by email to editorial@maldivesidylls.com.
- Fuego Grill at night under a banyan tree with woven hanging lanterns, Four Seasons Landaa Giraavaru.diningSourced from theluxurytravelexpert.com personal stay review (July 2025) for editorial reference. Takedown by email to editorial@maldivesidylls.com.
- Cafe Landaa A-frame pavilion at night, sand-floor courtyard with candle-lit benches, Four Seasons Landaa Giraavaru.diningSourced from theluxurytravelexpert.com personal stay review (July 2025) for editorial reference. Takedown by email to editorial@maldivesidylls.com.
- Blu Beach Club approach, bicycles parked along the sand path, Four Seasons Landaa Giraavaru.clubSourced from theluxurytravelexpert.com personal stay review (July 2025) for editorial reference. Takedown by email to editorial@maldivesidylls.com.
- Pool bar with white timber stools, thatched roof, Four Seasons Landaa Giraavaru.poolSourced from theluxurytravelexpert.com personal stay review (July 2025) for editorial reference. Takedown by email to editorial@maldivesidylls.com.
- Spa entrance pavilion with slate-tiled path, Four Seasons Landaa Giraavaru Ayurvedic Healing Centre.spaSourced from theluxurytravelexpert.com personal stay review (July 2025) for editorial reference. Takedown by email to editorial@maldivesidylls.com.
- Pristine beach at Four Seasons Landaa Giraavaru, overwater bungalow row visible on horizon.settingSourced from theluxurytravelexpert.com personal stay review (July 2025) for editorial reference. Takedown by email to editorial@maldivesidylls.com.
Furaveri Island Resort 12 images
- Furaveri Maldives, 168 villas on 23-hectare Meedhoo island, Raa Atoll, Maldivian-owned independent resort opened 2017.heroSource: https://dynamic-media-cdn.tripadvisor.com/media/photo-o/09/4d/7d/73/img-20151021-wa0024-largejpg.jpgTripadvisor property listing; takedown by email.
- resort-furaveri-island-resort-gallery-1-garden-villa-cathedral-ceilingvilla-beachFuraveri Maldives official.
- resort-furaveri-island-resort-gallery-2-beach-villa-palm-leaf-ceilingvilla-beachFuraveri Maldives official.
- resort-furaveri-island-resort-gallery-3-beach-pool-villa-draped-daybedvilla-beachFuraveri Maldives official.
- resort-furaveri-island-resort-gallery-5-ocean-pool-bathroom-outdoor-bathvilla-overwaterFuraveri Maldives official.
- resort-furaveri-island-resort-gallery-6-ocean-pool-bedroom-wood-louversvilla-overwaterFuraveri Maldives official.
- resort-furaveri-island-resort-gallery-7-beach-residence-two-pavilionvilla-beachFuraveri Maldives official.
- resort-furaveri-island-resort-gallery-8-wellness-gazebo-jacuzzispaFuraveri Maldives official.
- resort-furaveri-island-resort-gallery-9-sunset-pool-water-villa-draped-daybedvilla-overwaterFuraveri Maldives official.
- resort-furaveri-island-resort-gallery-10-beach-pool-manta-mosaicvilla-beachFuraveri Maldives official.
- resort-furaveri-island-resort-gallery-11-beach-couple-water-villa-clustersettingSource: https://www.neoscapesmaldives.com/wp-content/uploads/Lifestyle-Furaveri-Maldives-1-1024x683.jpgNeoscapes Maldives editorial.
- rejected-furaveri-wordmark-and-bathroom-clusterrejectedSource: various Furaveri assets
Fushifaru Maldives 5 images
- resort-fushifaru-maldives-heroheroSourced from Fushifaru operator microsite (independent boutique); takedown by email to editorial@maldivesidylls.com.
- resort-fushifaru-maldives-gallery-1-lagoon-suspended-hammock-signature-driftwood-postsaerialSource: Same as hero (dual-bound)Fushifaru microsite.
- resort-fushifaru-maldives-gallery-2-overwater-villa-row-gable-roof-twilight-warm-litvilla-overwaterFushifaru microsite.
- resort-fushifaru-maldives-gallery-3-villa-deck-gable-ceiling-plunge-pool-soft-violet-sunsetvilla-beachFushifaru microsite.
- resort-fushifaru-maldives-gallery-7-overwater-villa-aerial-paddleboard-couple-sup-activityactivitiesFushifaru microsite.
Gili Lankanfushi 9 images
- Gili Lankanfushi aerial, the multi-pod overwater villa configuration with turfed roofs visible from above.heroSourced from the official Gili Lankanfushi press image library for editorial review, with attribution. Photograph by Sandro Brücklmeier. Takedown by email to editorial@maldivesidylls.com.
- The Private Reserve at Gili Lankanfushi, multi-pavilion residence 500 metres off the main island.settingGili Lankanfushi press image library, editorial review. Takedown by email to editorial@maldivesidylls.com.
- Crusoe Residences cluster at Gili Lankanfushi, scattered standalone overwater pavilions in the lagoon.villa-overwaterGili Lankanfushi press image library, editorial review. Takedown by email to editorial@maldivesidylls.com.
- Crusoe Residence deck with overwater hammock and weathered-timber loungers, Gili Lankanfushi.villa-overwaterGili Lankanfushi press image library, editorial review. Takedown by email to editorial@maldivesidylls.com.
- Crusoe villa bedroom interior at Gili Lankanfushi, vaulted thatched ceiling and white canopy bed.villa-overwaterGili Lankanfushi press image library, editorial review. Takedown by email to editorial@maldivesidylls.com.
- Villa living pavilion at Gili Lankanfushi, low timber sofa with sliding doors open to the lagoon deck.villa-overwaterGili Lankanfushi press image library, editorial review. Takedown by email to editorial@maldivesidylls.com.
- Villa rooftop dining table under a thatched parasol at Gili Lankanfushi.villa-overwaterGili Lankanfushi press image library, editorial review. Takedown by email to editorial@maldivesidylls.com.
- Villa bathroom at Gili Lankanfushi, freestanding bathtub between reclaimed-timber vanities facing a lagoon picture window.villa-overwaterGili Lankanfushi press image library, editorial review. Takedown by email to editorial@maldivesidylls.com.
- Chocolate Room display case at Gili Lankanfushi By the Sea complex, labelled handmade truffles.diningGili Lankanfushi press image library, editorial review. Filename retained for backwards compatibility (was originally tagged 'wine-cellar' in error). Takedown by email to editorial@maldivesidylls.com.
Hard Rock Hotel Maldives 3 images
- resort-hard-rock-hotel-maldives-heroheroSourced from Hard Rock chain CDN; takedown by email to editorial@maldivesidylls.com.
- resort-hard-rock-hotel-maldives-gallery-2-platinum-overwater-villa-deck-multicolor-louvered-railing-signaturevilla-overwaterHard Rock chain CDN.
- resort-hard-rock-hotel-maldives-gallery-3-beach-villa-shingle-conical-bamboo-palm-frond-roof-signaturevilla-beachSource: Same as hero (dual-bound)Hard Rock chain CDN.
Heritance Aarah 11 images
- Heritance Aarah Maldives, 150 villas on Aarah island, Raa Atoll, Aitken Spence Heritance brand flagship opened December 2018.heroSource: https://dynamic-media-cdn.tripadvisor.com/media/photo-o/33/07/11/86/caption.jpg?w=1500&h=-1&s=1Sourced from the Tripadvisor property listing for editorial review, with attribution. Takedown by email to editorial@maldivesidylls.com.
- Arced overwater villa row aerial — 25+ A-frame thatched-roof villas with cantilevered green-tile plunge pools along the Aarah reef.settingSourced via eu-images.contentstack.com editorial; takedown by email to editorial@maldivesidylls.com.
- Heritance Ocean Pool Villa, two-story A-frame thatched-roof with cantilevered green-tile plunge pool over lagoon.villa-overwaterSourced via arenatours.com editorial; takedown by email to editorial@maldivesidylls.com.
- Heritance Beach Villa, A-frame thatched-roof with integrated turquoise-tile plunge pool, sea-grape and palm garden.villa-beachSourced via eu-images.contentstack.com editorial; takedown by email to editorial@maldivesidylls.com.
- Heritance Beach Villa interior, A-frame with exposed wooden trusses, king bed, daybed sofa, mosaic minibar console, sliding doors to garden.villa-beachSource: https://intourmaldives.com/wp-content/uploads/2024/04/HA_0002_Heritance-Aarah-Beach-Villa.jpgSourced via intourmaldives.com editorial; takedown by email to editorial@maldivesidylls.com.
- Ginifati private dining cone-pavilion cluster on the beach at twilight, soft amber lighting under cone-shaped thatched roofs.diningSourced via intourmaldives.com editorial; takedown by email to editorial@maldivesidylls.com.
- Overwater dining cluster (Ralu, Ambula, Hathaa overwater pavilions) at twilight with lit lounge daybeds on the deck and the main island beach beyond.diningSourced via maldives-magazine.com editorial; takedown by email to editorial@maldivesidylls.com.
- Hathaa overwater Japanese teppanyaki, chef performing live-flame show at the counter, woven bar chairs, OWV row and main island in background.diningSourced via maldives-magazine.com editorial; takedown by email to editorial@maldivesidylls.com.
- IASO Spa aerial showing the six thatched-roof overwater treatment pavilions clustered above the lagoon, connected by timber bridges to the spa reception and beach.spaSource: https://intourmaldives.com/wp-content/uploads/2024/04/HA_0015_Heritance-Aarah-SPA-Aerial-View.jpgSourced via intourmaldives.com editorial; takedown by email to editorial@maldivesidylls.com.
- Windsurfer crossing the deep Aarah lagoon under a red sail, overwater pavilion arm and beach-villa row visible along the right edge.activitiesSourced via intourmaldives.com editorial; takedown by email to editorial@maldivesidylls.com.
- Maldivian cultural exhibit pavilion, stone-walled enclosure with thatched entry housing framed historical photographs, two figures (one in traditional libaas) examining the display.lifestyleSource: https://intourmaldives.com/wp-content/uploads/2024/04/HA_0017_Heritance-Aarah-Maldivian-Village.jpgSourced via intourmaldives.com editorial; takedown by email to editorial@maldivesidylls.com.
Hideaway Beach Resort 12 images
- Hideaway Beach Resort & Spa, aerial view of Dhonakulhi private island, Haa Alif Atoll, Maldives.heroSourced from the Tripadvisor property listing for editorial review, with attribution. Takedown by email to editorial@maldivesidylls.com.
- Hideaway Beach Resort & Spa, aerial of Dhonakulhi crescent island with overwater villa arc, Haa Alif Atoll, MaldivesaerialHideaway Beach Resort & Spa microsite; takedown by email to editorial@maldivesidylls.com.
- Hideaway Beach Resort & Spa, beach villas with private pools on Dhonakulhi sand frontage, Haa Alif Atoll, Maldivesvilla-beachHideaway Beach Resort & Spa microsite; takedown by email to editorial@maldivesidylls.com.
- Hideaway Beach Resort & Spa, overwater villa cluster on stilts over Dhonakulhi lagoon eye-shape walkway, Haa Alif Atoll, Maldivesvilla-overwaterHideaway Beach Resort & Spa microsite; takedown by email to editorial@maldivesidylls.com.
- Hideaway Beach Resort & Spa, Matheefaru beachfront pavilion at dusk over water at end of lit jetty, Haa Alif Atoll, MaldivesdiningHideaway Beach Resort & Spa microsite; takedown by email to editorial@maldivesidylls.com.
- Hideaway Beach Resort & Spa, Hideaway Majesty motor yacht running off Dhonakulhi at sea, Haa Alif Atoll, MaldivessettingSource: https://www.hideawaybeachmaldives.com/wp-content/uploads/2024/05/Luxury-Yacht-Charter-scaled.jpgHideaway Beach Resort & Spa microsite; takedown by email to editorial@maldivesidylls.com.
- Hideaway Beach Resort & Spa, signature massage treatment with frangipani at Hideaway Spa, Haa Alif Atoll, MaldivesspaHideaway Beach Resort & Spa microsite; takedown by email to editorial@maldivesidylls.com.
- Hideaway Beach Resort & Spa, e-surf rider and Wibit floating aqua park on Dhonakulhi lagoon, Haa Alif Atoll, MaldivesactivitiesSource: https://www.hideawaybeachmaldives.com/wp-content/uploads/2024/05/9.Deep-Blue-Watersports.jpgHideaway Beach Resort & Spa microsite; takedown by email to editorial@maldivesidylls.com.
- Hideaway Beach Resort & Spa, Samsara Asian-fusion overwater pavilion at dusk, Haa Alif Atoll, MaldivesdiningHideaway Beach Resort & Spa microsite; takedown by email to editorial@maldivesidylls.com.
- Hideaway Beach Resort & Spa, Tender Hearts Kids Club wooden play tower interior with marine-life murals, Haa Alif Atoll, MaldivesactivitiesHideaway Beach Resort & Spa microsite; takedown by email to editorial@maldivesidylls.com.
- Hideaway Beach Resort & Spa, main peanut-shaped infinity pool aerial with central deck and palm canopy, Haa Alif Atoll, MaldivessettingHideaway Beach Resort & Spa microsite; takedown by email to editorial@maldivesidylls.com.
- Hideaway Beach Resort & Spa, MERIDIS PADI 5-star dive operation underwater shot, Haa Alif Atoll, MaldivesactivitiesHideaway Beach Resort & Spa microsite; takedown by email to editorial@maldivesidylls.com.
Holiday Inn Resort Kandooma 2 images
- resort-holiday-inn-resort-kandooma-heroheroSource: https://hoteliermaldives.com/wp-content/uploads/2026/04/batch_Overwater-Villas-at-Kandooma.pngSourced from Hotelier Maldives trade-press editorial; takedown by email to editorial@maldivesidylls.com.
- resort-holiday-inn-resort-kandooma-gallery-2-sunset-overwater-villa-deck-blue-cushion-loungers-glassy-lagoonvilla-overwaterSource: Same as hero (dual-bound)Hotelier Maldives.
Hurawalhi Island Resort 5 images
- resort-hurawalhi-island-resort-heroheroSourced from Hurawalhi operator microsite (Crown & Champa Resorts); takedown by email to editorial@maldivesidylls.com.
- resort-hurawalhi-island-resort-gallery-1-island-full-aerial-overwater-spa-pavilion-reef-edgeaerialHurawalhi microsite.
- resort-hurawalhi-island-resort-gallery-2-romantic-ocean-pool-villa-overwater-lounging-net-aerial-signaturevilla-beachHurawalhi microsite.
- resort-hurawalhi-island-resort-gallery-3-beach-sunset-pool-villa-twilight-lime-mustard-accent-deckvilla-beachHurawalhi microsite.
- resort-hurawalhi-island-resort-gallery-4-5-8-undersea-restaurant-acrylic-tunnel-fish-schooling-signaturediningSource: Same as hero (dual-bound)Hurawalhi microsite.
Huvafen Fushi 3 images
- resort-huvafen-fushi-heroheroSourced from Huvafen Fushi operator microsite (Per Aquum boutique) via NitroCDN; takedown by email to editorial@maldivesidylls.com.
- resort-huvafen-fushi-gallery-1-huvafen-fushi-aerial-dhoni-sailboat-arrival-pavilion-islandaerialSource: Same as hero (dual-bound)Huvafen Fushi microsite NitroCDN.
Ifuru Island Maldives 9 images
- Ifuru Island Maldives full-island aerial showing the private airstrip running the length of the island (direct fly-in resort, no seaplane required).heroSourced via Bing-bypass / neoscapesmaldives.com editorial; takedown by email to editorial@maldivesidylls.com.
- Main-pool drone aerial — dumbbell-shaped pool with circular thatched-roof central pavilion, palm-shaded sun-loungers, beach frontage.aerialSourced from Hotelier Maldives trade-press editorial; takedown by email to editorial@maldivesidylls.com.
- Beach Villa with Pool multi-angle composite (exterior + bedroom + bath + deck breakfast).villa-beachSourced via maldives-magazine.com editorial; takedown by email to editorial@maldivesidylls.com.
- The Beach Club casual day venue with clapboard pavilion, surfboard signage, tasseled umbrellas, beanbag clusters.diningSourced from Hotelier Maldives trade-press editorial; takedown by email to editorial@maldivesidylls.com.
- Hubba Hubba sundowner destination-dining setup with hurricane-lantern path at dusk, couple walking.diningSource: https://hoteliermaldives.com/wp-content/uploads/2026/02/Destination-Dining-Lifestyle-scaled.jpgSourced from Hotelier Maldives trade-press editorial; takedown by email to editorial@maldivesidylls.com.
- Hubba Hubba bar interior — pavilion roof, woven pendants, blue signage, bar counter with floral chairs, sofa lounge, pink tower visible.diningSourced from Hotelier Maldives trade-press editorial; takedown by email to editorial@maldivesidylls.com.
- Coconut Kids Club branded pavilion (pale-blue gabled thatched roof) with adjacent splash-zone water park.lifestyleSource: https://hoteliermaldives.com/wp-content/uploads/2026/01/Coconut-Kids-Club_Water-Park-scaled.jpgSourced from Hotelier Maldives trade-press editorial; takedown by email to editorial@maldivesidylls.com.
- The pink Hubba Hubba sundowner tower on the 1.2-kilometre west-facing beach — property signature icon.settingSourced from Hotelier Maldives trade-press editorial; takedown by email to editorial@maldivesidylls.com.
- Island Reserve large-group accommodation composite — aerial row, bedroom, bath, outdoor lounge.villa-multi-bedroomSourced via maldives-magazine.com editorial; takedown by email to editorial@maldivesidylls.com.
Innahura Maldives Resort 28 images
- Innahura (now Nala Maldives) aerial of the Lhaviyani Atoll island.heroSourced from the official Nala Maldives (formerly Innahura Maldives Resort) press image library for editorial review. Takedown by email to editorial@maldivesidylls.com.
- Innahura (now Nala Maldives) aerial of the Lhaviyani Atoll island.heroSourced from the official Nala Maldives (formerly Innahura Maldives Resort) press image library for editorial review. Takedown by email to editorial@maldivesidylls.com.
- Nala Maldives by Jawakara (formerly Innahura) drone aerial showing the Olhu Bar over-water pavilion on a sand spit, beach pool villas at the foreground, neighbouring Lhaviyani island in the background.gallery
- Nala Maldives by Jawakara setting view: drone aerial of the Olhu Bar over-water pavilion at the sand-spit terminus, jetty walkway, palm island edge, and the wide Lhaviyani Atoll lagoon.gallery
- Nala Maldives by Jawakara (formerly Innahura) drone aerial showing the Olhu Bar over-water pavilion on a sand spit, beach pool villas at the foreground, neighbouring Lhaviyani island in the background.gallery
- Nala Maldives by Jawakara setting view: drone aerial of the Olhu Bar over-water pavilion at the sand-spit terminus, jetty walkway, palm island edge, and the wide Lhaviyani Atoll lagoon.gallery
- Nala Maldives by Jawakara (formerly Innahura) drone aerial showing the Olhu Bar over-water pavilion on a sand spit, beach pool villas at the foreground, neighbouring Lhaviyani island in the background.gallery
- Nala Maldives by Jawakara setting view: drone aerial of the Olhu Bar over-water pavilion at the sand-spit terminus, jetty walkway, palm island edge, and the wide Lhaviyani Atoll lagoon.gallery
- Nala Maldives by Jawakara (formerly Innahura) drone aerial showing the Olhu Bar over-water pavilion on a sand spit, beach pool villas at the foreground, neighbouring Lhaviyani island in the background.gallery
- Nala Maldives by Jawakara setting view: drone aerial of the Olhu Bar over-water pavilion at the sand-spit terminus, jetty walkway, palm island edge, and the wide Lhaviyani Atoll lagoon.gallery
- Nala Maldives by Jawakara (formerly Innahura) drone aerial showing the Olhu Bar over-water pavilion on a sand spit, beach pool villas at the foreground, neighbouring Lhaviyani island in the background.gallery
- Nala Maldives by Jawakara setting view: drone aerial of the Olhu Bar over-water pavilion at the sand-spit terminus, jetty walkway, palm island edge, and the wide Lhaviyani Atoll lagoon.gallery
- Nala Maldives by Jawakara (formerly Innahura) drone aerial showing the Olhu Bar over-water pavilion on a sand spit, beach pool villas at the foreground, neighbouring Lhaviyani island in the background.gallery
- Nala Maldives by Jawakara setting view: drone aerial of the Olhu Bar over-water pavilion at the sand-spit terminus, jetty walkway, palm island edge, and the wide Lhaviyani Atoll lagoon.gallery
- Nala Maldives by Jawakara (formerly Innahura) drone aerial showing the Olhu Bar over-water pavilion on a sand spit, beach pool villas at the foreground, neighbouring Lhaviyani island in the background.gallery
- Nala Maldives by Jawakara setting view: drone aerial of the Olhu Bar over-water pavilion at the sand-spit terminus, jetty walkway, palm island edge, and the wide Lhaviyani Atoll lagoon.gallery
- Nala Maldives by Jawakara (formerly Innahura) drone aerial showing the Olhu Bar over-water pavilion on a sand spit, beach pool villas at the foreground, neighbouring Lhaviyani island in the background.gallery
- Nala Maldives by Jawakara setting view: drone aerial of the Olhu Bar over-water pavilion at the sand-spit terminus, jetty walkway, palm island edge, and the wide Lhaviyani Atoll lagoon.gallery
- Nala Maldives by Jawakara (formerly Innahura) drone aerial showing the Olhu Bar over-water pavilion on a sand spit, beach pool villas at the foreground, neighbouring Lhaviyani island in the background.gallery
- Nala Maldives by Jawakara setting view: drone aerial of the Olhu Bar over-water pavilion at the sand-spit terminus, jetty walkway, palm island edge, and the wide Lhaviyani Atoll lagoon.gallery
- Nala Maldives by Jawakara (formerly Innahura) drone aerial showing the Olhu Bar over-water pavilion on a sand spit, beach pool villas at the foreground, neighbouring Lhaviyani island in the background.gallery
- Nala Maldives by Jawakara setting view: drone aerial of the Olhu Bar over-water pavilion at the sand-spit terminus, jetty walkway, palm island edge, and the wide Lhaviyani Atoll lagoon.gallery
- Nala Maldives by Jawakara (formerly Innahura) drone aerial showing the Olhu Bar over-water pavilion on a sand spit, beach pool villas at the foreground, neighbouring Lhaviyani island in the background.gallery
- Nala Maldives by Jawakara setting view: drone aerial of the Olhu Bar over-water pavilion at the sand-spit terminus, jetty walkway, palm island edge, and the wide Lhaviyani Atoll lagoon.gallery
- Nala Maldives by Jawakara (formerly Innahura) drone aerial showing the Olhu Bar over-water pavilion on a sand spit, beach pool villas at the foreground, neighbouring Lhaviyani island in the background.gallery
- Nala Maldives by Jawakara setting view: drone aerial of the Olhu Bar over-water pavilion at the sand-spit terminus, jetty walkway, palm island edge, and the wide Lhaviyani Atoll lagoon.gallery
- Nala Maldives by Jawakara (formerly Innahura) drone aerial showing the Olhu Bar over-water pavilion on a sand spit, beach pool villas at the foreground, neighbouring Lhaviyani island in the background.gallery
- Nala Maldives by Jawakara setting view: drone aerial of the Olhu Bar over-water pavilion at the sand-spit terminus, jetty walkway, palm island edge, and the wide Lhaviyani Atoll lagoon.gallery
Intercontinental Maamunagau 11 images
- DJI drone aerial of the connecting islet with elevated pool and manta-pavilion roof — IC Maamunagau signature.heroSourced from InterContinental Maldives Maamunagau regional microsite (IHG); takedown by email to editorial@maldivesidylls.com.
- Connecting-islet aerial — elevated pool, manta pavilion, encircled lagoon.aerialIHG IC Maamunagau microsite.
- Overwater Pool Villa deck with green-mosaic plunge pool, rough-hewn pergola, kayak racked.villa-overwaterCarrier.co.uk editorial.
- Sunset Beach Pool Villa with thatched-pyramid roof and green-mosaic step-cascade plunge pool.villa-beachCarrier.co.uk editorial.
- Fish Market overwater dining deck at sunset, family of four, hurricane-lantern sconces.diningIHG IC Maamunagau microsite.
- The Retreat adults-only dining pavilion interior, peaked rafters, saffron banquettes.settingIHG IC Maamunagau microsite.
- AVI SPA overwater treatment pavilion — circular domed ceiling, massage bed, round soaking tub, lagoon view.spaMaldives.com editorial.
- Planet Trekkers Kids Club interior with pirate-ship play frame, pastel tables, board-game shelves.lifestyleSourced via intourmaldives.com editorial; takedown by email to editorial@maldivesidylls.com.
- The Lighthouse open kitchen with chefs, blue arches, Mediterranean blue-and-white tile, copper utensils.diningSourced via Elite Traveler editorial; takedown by email to editorial@maldivesidylls.com.
- 3-Bedroom Overwater Pool Residence — thatched two-story, infinity pool, glass-bottom relaxation pod.villa-multi-bedroomSourced via Elite Traveler editorial; takedown by email to editorial@maldivesidylls.com.
- The Collective family cooking-class kitchen, chef at pizza counter, family at the counter, yellow rafters.diningSourced via Elite Traveler editorial; takedown by email to editorial@maldivesidylls.com.
Iru Veli Sun Siyam 2 images
- resort-iru-veli-sun-siyam-heroheroSourced from sunsiyam.com operator microsite (Sun Siyam Resorts; Umbraco CMS /media/ asset path); takedown by email to editorial@maldivesidylls.com.
- resort-iru-veli-sun-siyam-gallery-1-maaenboodhoo-crescent-overwater-villa-row-aerial-iru-restaurant-pavilion-signatureaerialSource: Same as hero (dual-bound)Sun Siyam operator microsite (Umbraco CMS).
Joali Being 1 images
Joali Maldives 8 images
- JOALI Maldives — Mura Bar poolside, lifestyle scene with coconut drink.heroSourced from the resort's official communications (joali.com) for editorial review, with attribution. Takedown requests honoured on email to editorial@maldivesidylls.com.
- JOALI Maldives horseshoe-shaped overwater boardwalk aerial, Muravandhoo island.settingSource: https://www.joali.com/media/gbwlbfcs/joali-maldives-over-water-villas_aerial_view-_1100x1000px.jpgSourced from the resort's official communications (joali.com) for editorial review, with attribution. Takedown requests honoured on email to editorial@maldivesidylls.com.
- Sunset Water Villa with Pool exterior at JOALI Maldives, infinity-edge plunge pool.villa-overwaterEditorial-review use with attribution (travelplusstyle.com); takedown by email to editorial@maldivesidylls.com.
- Saoke teppanyaki overwater pavilion at JOALI Maldives at twilight.dining-saokeSourced from the resort's official communications (joali.com) for editorial review, with attribution. Takedown requests honoured on email to editorial@maldivesidylls.com.
- Vandhoo all-day pavilion at JOALI Maldives, signature curved origami-thatched roof.dining-vandhooSourced from the resort's official communications (joali.com) for editorial review, with attribution. Takedown requests honoured on email to editorial@maldivesidylls.com.
- ESPA at JOALI Maldives — Porky Hefer commissioned treehouse spa pavilion.spaEditorial-review use with attribution (Forbes Travel Guide credit-line 'CreditJOALIMaldives'); takedown by email to editorial@maldivesidylls.com.
- Manta Ray / Kara fish-chair sculpture by Porky Hefer at JOALI Maldives beach.artEditorial-review use with attribution (Forbes Travel Guide credit-line 'CreditJOALIMaldives'); takedown by email to editorial@maldivesidylls.com.
- Curator-led art tour engagement with bronze heron sculpture inside Vandhoo pavilion, JOALI Maldives.art-tourSourced from the resort's official communications (joali.com) for editorial review, with attribution. Takedown requests honoured on email to editorial@maldivesidylls.com.
Jw Marriott Maldives 13 images
- JW Marriott Maldives Resort & Spa, 60 villas on Vagaru island, Shaviyani Atoll, opened 2019.heroSourced from the Tripadvisor property listing for editorial review, with attribution. Takedown by email to editorial@maldivesidylls.com.
- JW Marriott Maldives Resort & Spa, aerial of Vagaru island with overwater villas extending into Shaviyani western reef lagoon, MaldivesaerialTripadvisor property listing CDN; takedown by email to editorial@maldivesidylls.com.
- JW Marriott Maldives Resort & Spa, Duplex Beach Villa aerial with curved-edge private pool, Shaviyani Atoll, Maldivesvilla-beachhoteliermaldives.com multigenerational travel feature; takedown by email to editorial@maldivesidylls.com.
- JW Marriott Maldives Resort & Spa, Beach Pool Villa top-down with segmented-petal thatched roof, Shaviyani Atoll, Maldivesvilla-beachneoscapesmaldives.com (MLEJS press kit); takedown by email to editorial@maldivesidylls.com.
- JW Marriott Maldives Resort & Spa, Overwater Pool Villa twilight exterior with scalloped thatched roof and lit pool, Shaviyani Atoll, Maldivesvilla-overwaterneoscapesmaldives.com (MLEJS press kit); takedown by email to editorial@maldivesidylls.com.
- JW Marriott Maldives Resort & Spa, Duplex Overwater Villa top-down with teardrop thatched roof, Shaviyani Atoll, Maldivesvilla-overwaterneoscapesmaldives.com (MLEJS press kit); takedown by email to editorial@maldivesidylls.com.
- JW Marriott Maldives Resort & Spa, RIHA destination dining sunken curved-concrete amphitheatre with chef plating to couple, Shaviyani Atoll, Maldivesdininghoteliermaldives.com Nowruz Celebrations feature; takedown by email to editorial@maldivesidylls.com.
- JW Marriott Maldives Resort & Spa, SPA by JW yoga pavilion with palm-leaf-cut wood screens and overwater walkway, Shaviyani Atoll, Maldivesspahoteliermaldives.com Earth Day wellness feature; takedown by email to editorial@maldivesidylls.com.
- JW Marriott Maldives Resort & Spa, Little Griffins Kids' Club pirate-ship play structure and round kids' pool, Shaviyani Atoll, MaldivesactivitiesSource: https://hoteliermaldives.com/wp-content/uploads/2026/03/batch_JW_MLEJS_Kids-Club-Pirate-Ship.jpghoteliermaldives.com multigenerational travel feature; takedown by email to editorial@maldivesidylls.com.
- JW Marriott Maldives Resort & Spa, family on property beach with OWV cluster anchoring the horizon, Shaviyani Atoll, Maldivesactivitieshoteliermaldives.com multigenerational travel feature; takedown by email to editorial@maldivesidylls.com.
- JW Marriott Maldives Resort & Spa, family arrival on jetty disembarking TMA seaplane with welcome staff, Shaviyani Atoll, MaldivessettingSource: https://hoteliermaldives.com/wp-content/uploads/2026/03/batch_JW-Marriott-Maldives-Arrival-shot.jpghoteliermaldives.com multigenerational travel feature; takedown by email to editorial@maldivesidylls.com.
- JW Marriott Maldives Resort & Spa, JW Garden entrance with driftwood signboard and vine-laden archway, Shaviyani Atoll, Maldivessettinghoteliermaldives.com Earth Day garden feature; takedown by email to editorial@maldivesidylls.com.
- JW Marriott Maldives Resort & Spa, Vagaru sunset aerial with palm canopy and overwater villa silhouette, Shaviyani Atoll, Maldivesaerialneoscapesmaldives.com (MLEJS press kit); takedown by email to editorial@maldivesidylls.com.
Kandima Maldives 3 images
- resort-kandima-maldives-heroheroSourced from kandima.com operator microsite (Pulse Hotels & Resorts; yootheme Joomla); takedown by email to editorial@maldivesidylls.com.
- resort-kandima-maldives-gallery-2-beach-pool-villa-exterior-red-lounger-signature-private-plunge-poolvilla-beachSourced from kandima.com operator microsite; takedown by email to editorial@maldivesidylls.com.
- resort-kandima-maldives-gallery-3-aqua-villa-overwater-bathroom-floor-to-ceiling-glass-pop-color-signaturevilla-overwaterSourced from kandima.com operator microsite; takedown by email to editorial@maldivesidylls.com.
Kandolhu Maldives 7 images
- resort-kandolhu-maldives-heroheroSourced from kandolhu.com operator microsite (Cloudflare-protected WordPress; Safari UA 200 OK); takedown by email to editorial@maldivesidylls.com.
- resort-kandolhu-maldives-gallery-1-boutique-triangular-island-top-down-drone-aerial-30-villa-clusteraerialSource: Same as hero (dual-bound)kandolhu.com operator microsite.
- resort-kandolhu-maldives-gallery-2-ocean-pool-villa-open-side-bathroom-infinity-edge-cantilevered-plunge-poolvilla-overwaterkandolhu.com operator microsite.
- resort-kandolhu-maldives-gallery-3-duplex-pool-villa-two-storey-a-frame-thatched-roof-canopy-aerialvilla-beachkandolhu.com operator microsite.
- resort-kandolhu-maldives-gallery-4-the-market-olive-double-tier-circular-thatched-dining-pavilion-cinematic-duskdiningkandolhu.com operator microsite.
- resort-kandolhu-maldives-gallery-6-varu-spa-cathedral-arch-pavilion-curved-timber-rafter-vault-signaturespakandolhu.com operator microsite.
- resort-kandolhu-maldives-gallery-7-ocean-villa-row-aerial-house-reef-directly-below-villas-signaturesettingkandolhu.com operator microsite.
Kanuhura Maldives 6 images
- Kanuhura (now Six Senses Kanuhura) aerial of the Lhaviyani Atoll island.heroSourced from a Six Senses Kanuhura editorial press surface (PressBeyond / Cloudfront CDN). Takedown by email to editorial@maldivesidylls.com.
- Six Senses Kanuhura drone aerial: long narrow palm-covered Kanuhura island stretching toward the horizon, white sand beach perimeter, beach pool villas clustered along the spine, signature spa pod with circular plunge pool at the foreground, OWV cluster at the far end, encircling turquoise lagoon, Lhaviyani Atoll.gallery
- Six Senses Kanuhura drone aerial: long narrow palm-covered Kanuhura island stretching toward the horizon, white sand beach perimeter, beach pool villas clustered along the spine, signature spa pod with circular plunge pool at the foreground, OWV cluster at the far end, encircling turquoise lagoon, Lhaviyani Atoll.gallery
- Six Senses Kanuhura spa treatment pavilion: vaulted timber rafter ceiling, central glass-tile plunge pool with mosaic floor, sun lounger at left, terracotta-clay walls, open frontage onto a small plumeria-tree garden courtyard.gallery
- Six Senses Kanuhura drone aerial: long narrow palm-covered Kanuhura island stretching toward the horizon, white sand beach perimeter, beach pool villas clustered along the spine, signature spa pod with circular plunge pool at the foreground, OWV cluster at the far end, encircling turquoise lagoon, Lhaviyani Atoll.gallery
- Six Senses Kanuhura spa treatment pavilion: vaulted timber rafter ceiling, central glass-tile plunge pool with mosaic floor, sun lounger at left, terracotta-clay walls, open frontage onto a small plumeria-tree garden courtyard.gallery
Kihaa Maldives 3 images
- resort-kihaa-maldives-heroheroSourced from kihaamaldives.com operator microsite (open WordPress); takedown by email to editorial@maldivesidylls.com.
- resort-kihaa-maldives-gallery-1-overwater-villa-cross-jetty-thatched-cluster-architectural-aerialaerialkihaamaldives.com operator microsite.
- resort-kihaa-maldives-gallery-2-water-suite-interior-circular-timber-rafter-ceiling-rattan-ikat-blue-palettevilla-overwaterkihaamaldives.com operator microsite.
Komandoo Island Resort 3 images
- resort-komandoo-island-resort-heroheroSourced from komandoo.com operator microsite (Crown & Champa Resorts; www. subdomain — apex 301 infinite-loop misconfig); takedown by email to editorial@maldivesidylls.com.
- resort-komandoo-island-resort-gallery-1-isolated-oval-island-breakwater-perimeter-golden-hour-aerial-alt-angleaerialkomandoo.com operator microsite.
- resort-komandoo-island-resort-gallery-3-water-villa-row-thatched-pyramid-overwater-curved-arc-jetty-aerialvilla-overwaterkomandoo.com operator microsite.
Kudadoo Maldives Private Island 5 images
- resort-kudadoo-maldives-private-island-heroheroSourced from kudadoo.com operator microsite (Crown & Champa Resorts; WordPress); takedown by email to editorial@maldivesidylls.com.
- resort-kudadoo-maldives-private-island-gallery-1-solar-powered-private-island-c-arc-overwater-villa-row-the-retreat-2026-aerialaerialSource: Same as hero (dual-bound)kudadoo.com operator microsite.
- resort-kudadoo-maldives-private-island-gallery-2-ocean-residence-private-deck-infinity-plunge-pool-reef-shallow-cantileveredvilla-overwaterkudadoo.com operator microsite.
- resort-kudadoo-maldives-private-island-gallery-4-the-retreat-massive-sloped-solar-panel-roof-amoeba-infinity-pool-signatureactivitieskudadoo.com operator microsite.
- resort-kudadoo-maldives-private-island-gallery-5-perfect-circular-all-overwater-villa-ring-island-centre-aerial-signaturesettingkudadoo.com operator microsite.
Kuramathi Island Resort 10 images
- Kuramathi water bungalow row in curved arc along reef-edge.heroSourced from kuramathi.com (now nivakuramathi.com) operator microsite (Universal Resorts; WordPress via NitroCDN).
- Long arc water bungalow row drone aerial.aerialSource: Same as hero (dual-bound)kuramathi.com operator microsite (NitroCDN).
- Iconic Kuramathi sandbank tip with figure, OWV row in distance.settingSourced via simply-madeleine.com editorial review; takedown by email to editorial@maldivesidylls.com.
- Deluxe Water Villa bedroom with Welcome to Kuramathi embroidered runner.villa-overwaterSource: https://simply-madeleine.com/wp-content/uploads/2021/05/Kuramathi-Deluxe-Water-Villa-Bedroom.jpgSourced via simply-madeleine.com editorial review.
- Deluxe Water Villa bathroom — freestanding tub, twin round mirrors.villa-overwaterSource: https://simply-madeleine.com/wp-content/uploads/2021/05/Kuramathi-Deluxe-Water-Villa-Bathroom.jpgSourced via simply-madeleine.com editorial review.
- Deluxe Water Villa outdoor shower deck.villa-overwaterSourced via simply-madeleine.com editorial review.
- Farivalhu buffet yuzu meringue tart dessert display.diningSourced via simply-madeleine.com editorial review.
- SUP paddleboarder in shallow lagoon with palm coast in distance.activitiesSourced via simply-madeleine.com editorial review.
- Snorkelling pair on jetty with blue fins, OWV row in distance.activitiesSourced via simply-madeleine.com editorial review.
- Overwater spa pavilion at end of long jetty.spaSourced via mymaldives.com.au editorial.
Kuredu Resort 3 images
- resort-kuredu-resort-heroheroSourced from kuredu.com operator microsite (Crown & Champa Resorts); takedown by email to editorial@maldivesidylls.com.
- resort-kuredu-resort-gallery-1-elongated-thin-reef-island-full-aerial-overwater-row-jetty-clusteraerialSource: Same as hero (dual-bound)kuredu.com operator microsite.
- resort-kuredu-resort-gallery-2-sangu-water-villa-thatched-conical-pyramid-roof-private-deck-plunge-pool-aerial-signaturevilla-overwaterSource: https://www.kuredu.com/wp-content/uploads/2025/04/Birds-Eye-of-Sangu-Water-Villas1600x900.jpgkuredu.com operator microsite.
Kurumba Maldives 27 images
- Kurumba (now NIVA Kurumba) beach, North Malé Atoll.heroSourced from the official NIVA Kurumba press image library for editorial review. Takedown by email to editorial@maldivesidylls.com.
- Kurumba Maldives drone aerial showing the property's signature terracotta-tiled bungalow cluster nestled in coconut palm canopy, tennis court and pool visible at the upper edge, white sand beach and turquoise lagoon framing the southern perimeter of Vihamanaafushi.gallery
- Kurumba Maldives Superior Bungalow interior: vaulted wooden ceiling, TV on light-wood cabinet, neutral daybed against textile-panelled wall, sliding glass door to terrace with green cushion bench and palm view.gallery
- Kurumba Maldives drone aerial showing the property's signature terracotta-tiled bungalow cluster nestled in coconut palm canopy, tennis court and pool visible at the upper edge, white sand beach and turquoise lagoon framing the southern perimeter of Vihamanaafushi.gallery
- Kurumba Maldives Superior Bungalow interior: vaulted wooden ceiling, TV on light-wood cabinet, neutral daybed against textile-panelled wall, sliding glass door to terrace with green cushion bench and palm view.gallery
- Kurumba Maldives drone aerial showing the property's signature terracotta-tiled bungalow cluster nestled in coconut palm canopy, tennis court and pool visible at the upper edge, white sand beach and turquoise lagoon framing the southern perimeter of Vihamanaafushi.gallery
- Kurumba Maldives Superior Bungalow interior: vaulted wooden ceiling, TV on light-wood cabinet, neutral daybed against textile-panelled wall, sliding glass door to terrace with green cushion bench and palm view.gallery
- Kurumba Maldives drone aerial showing the property's signature terracotta-tiled bungalow cluster nestled in coconut palm canopy, tennis court and pool visible at the upper edge, white sand beach and turquoise lagoon framing the southern perimeter of Vihamanaafushi.gallery
- Kurumba Maldives Superior Bungalow interior: vaulted wooden ceiling, TV on light-wood cabinet, neutral daybed against textile-panelled wall, sliding glass door to terrace with green cushion bench and palm view.gallery
- Kurumba Maldives drone aerial showing the property's signature terracotta-tiled bungalow cluster nestled in coconut palm canopy, tennis court and pool visible at the upper edge, white sand beach and turquoise lagoon framing the southern perimeter of Vihamanaafushi.gallery
- Kurumba Maldives Superior Bungalow interior: vaulted wooden ceiling, TV on light-wood cabinet, neutral daybed against textile-panelled wall, sliding glass door to terrace with green cushion bench and palm view.gallery
- Kurumba Maldives drone aerial showing the property's signature terracotta-tiled bungalow cluster nestled in coconut palm canopy, tennis court and pool visible at the upper edge, white sand beach and turquoise lagoon framing the southern perimeter of Vihamanaafushi.gallery
- Kurumba Maldives Superior Bungalow interior: vaulted wooden ceiling, TV on light-wood cabinet, neutral daybed against textile-panelled wall, sliding glass door to terrace with green cushion bench and palm view.gallery
- Kurumba Maldives drone aerial showing the property's signature terracotta-tiled bungalow cluster nestled in coconut palm canopy, tennis court and pool visible at the upper edge, white sand beach and turquoise lagoon framing the southern perimeter of Vihamanaafushi.gallery
- Kurumba Maldives Superior Bungalow interior: vaulted wooden ceiling, TV on light-wood cabinet, neutral daybed against textile-panelled wall, sliding glass door to terrace with green cushion bench and palm view.gallery
- Kurumba Maldives drone aerial showing the property's signature terracotta-tiled bungalow cluster nestled in coconut palm canopy, tennis court and pool visible at the upper edge, white sand beach and turquoise lagoon framing the southern perimeter of Vihamanaafushi.gallery
- Kurumba Maldives Superior Bungalow interior: vaulted wooden ceiling, TV on light-wood cabinet, neutral daybed against textile-panelled wall, sliding glass door to terrace with green cushion bench and palm view.gallery
- Kurumba Maldives drone aerial showing the property's signature terracotta-tiled bungalow cluster nestled in coconut palm canopy, tennis court and pool visible at the upper edge, white sand beach and turquoise lagoon framing the southern perimeter of Vihamanaafushi.gallery
- Kurumba Maldives Superior Bungalow interior: vaulted wooden ceiling, TV on light-wood cabinet, neutral daybed against textile-panelled wall, sliding glass door to terrace with green cushion bench and palm view.gallery
- Kurumba Maldives drone aerial showing the property's signature terracotta-tiled bungalow cluster nestled in coconut palm canopy, tennis court and pool visible at the upper edge, white sand beach and turquoise lagoon framing the southern perimeter of Vihamanaafushi.gallery
- Kurumba Maldives Superior Bungalow interior: vaulted wooden ceiling, TV on light-wood cabinet, neutral daybed against textile-panelled wall, sliding glass door to terrace with green cushion bench and palm view.gallery
- Kurumba Maldives drone aerial showing the property's signature terracotta-tiled bungalow cluster nestled in coconut palm canopy, tennis court and pool visible at the upper edge, white sand beach and turquoise lagoon framing the southern perimeter of Vihamanaafushi.gallery
- Kurumba Maldives Superior Bungalow interior: vaulted wooden ceiling, TV on light-wood cabinet, neutral daybed against textile-panelled wall, sliding glass door to terrace with green cushion bench and palm view.gallery
- Kurumba Maldives drone aerial showing the property's signature terracotta-tiled bungalow cluster nestled in coconut palm canopy, tennis court and pool visible at the upper edge, white sand beach and turquoise lagoon framing the southern perimeter of Vihamanaafushi.gallery
- Kurumba Maldives Superior Bungalow interior: vaulted wooden ceiling, TV on light-wood cabinet, neutral daybed against textile-panelled wall, sliding glass door to terrace with green cushion bench and palm view.gallery
- Kurumba Maldives drone aerial showing the property's signature terracotta-tiled bungalow cluster nestled in coconut palm canopy, tennis court and pool visible at the upper edge, white sand beach and turquoise lagoon framing the southern perimeter of Vihamanaafushi.gallery
- Kurumba Maldives Superior Bungalow interior: vaulted wooden ceiling, TV on light-wood cabinet, neutral daybed against textile-panelled wall, sliding glass door to terrace with green cushion bench and palm view.gallery
Le Meridien Maldives 3 images
- resort-le-meridien-maldives-heroheroSource: cache.marriott.com.cn /MLEMD/md-mlemd-mer-mlemd-aerial-shots-ov-33819-wide-hor.jpg (Bing-bypass)Sourced via Bing-bypass / cache.marriott.com.cn property CDN; takedown by email to editorial@maldivesidylls.com.
- resort-le-meridien-maldives-gallery-1-thilamaafushi-double-bent-overwater-villa-row-curved-geometry-aerial-signatureaerialSource: Same as hero (dual-bound)Marriott property CDN via Bing-bypass.
- resort-le-meridien-maldives-gallery-2-sunset-overwater-pool-villa-private-deck-twilight-grey-violet-sky-horizonvilla-overwaterSourced via upgradedpoints.com editorial; takedown by email to editorial@maldivesidylls.com.
Lily Beach Resort 13 images
- Huvahendhoo dusk panoramic aerial with red-tile-roof OWV arc.heroSourced from lilybeachmaldives.com operator microsite (Lily Hotels Group, Maldivian-owned independent operator since 1994); takedown by email to editorial@maldivesidylls.com.
- Huvahendhoo red-tile-roof OWV arc dusk panoramic.aerialSource: Same as hero (dual-bound)lilybeachmaldives.com operator microsite.
- Beach Villa interior — dark hardwood, king bed, daybed alcove.villa-beachSourced from lilybeachmaldives.com operator microsite.
- Family Villa with Pool — mosaic tile pool, twin red-roof gables.villa-beachlilybeachmaldives.com operator microsite.
- Deluxe Water Villa — glass-floor lagoon panel, bedroom alcove.villa-overwaterSourced from lilybeachmaldives.com operator microsite.
- Sunset Water Villa with Pool — oval tub, infinity plunge, dusk.villa-overwaterSource: https://www.lilybeachmaldives.com/wp-content/uploads/2015/06/Lily_Beach_Sunset_Water_Villa_16.jpgSourced from lilybeachmaldives.com operator microsite.
- Tamara Spa overwater jacuzzi — rose petal, frangipani, lagoon view.spaletsgo.lilybeachmaldives.com (Lily Beach campaign sub-domain).
- Tamarind over-water Thai — gold-disc cascade chandelier, red banquettes.diningSourced from lilybeachmaldives.com operator microsite.
- Lily Maa principal buffet — exposed truss, fairy-light cascade.diningSourced from lilybeachmaldives.com operator microsite.
- Aqva pool-edge restaurant at twilight — wicker chairs, candle lanterns.diningSourced from lilybeachmaldives.com operator microsite.
- Manta ray over orange-anthias swarm at South Ari cleaning station.activitiesSourced from lilybeachmaldives.com operator microsite.
- Tamara Spa overwater cluster aerial — five-pavilion radial geometry.spaSourced from lilybeachmaldives.com operator microsite.
- Sunset cruise on Himmath dhoni — curved stem silhouette, orange sun.activitiesSourced from lilybeachmaldives.com operator microsite (property-branded vessel).
Lux South Ari Atoll 9 images
- Dhidhoofinolhu sunset aerial with TMA Twin Otter near OWV row.heroSourced from luxresorts.com operator microsite (LUX* Resorts / IBL Mauritian group).
- Dhidhoofinolhu sunset aerial.aerialSource: Same as hero (dual-bound)luxresorts.com operator microsite.
- Refurbished Water Villa row aerial.aerialSource: https://hoteliermaldives.com/wp-content/uploads/2025/02/batch_Aerial-Water-Villas-3_1864x1242.jpgHotelier Maldives trade-press editorial covering 2025 OWV refurbishment.
- Refurbished Water Villa deck.villa-overwaterHotelier Maldives trade-press editorial.
- Refurbished Water Villa bedroom.villa-overwaterHotelier Maldives trade-press editorial.
- Refurbished Water Villa bathroom.villa-overwaterHotelier Maldives trade-press editorial.
- Cyclists on jetty, 1.8 km longer-axis daily movement.settingHotelier Maldives trade-press editorial.
- PLAY Kids Club pastel pavilion.activitiesHotelier Maldives trade-press editorial.
- Powder-blue jet car carving lagoon, SSOV amenity.activitiesHotelier Maldives trade-press editorial.
Medhufushi Island Resort 2 images
- resort-medhufushi-island-resort-heroheroSourced from Hotelier Maldives trade-press editorial (operator microsite parked); takedown by email to editorial@maldivesidylls.com.
- resort-medhufushi-island-resort-gallery-1-overwater-jetty-bungalow-classic-maldives-editorial-composition-aerial-contextaerialSource: Same as hero (dual-bound)Hotelier Maldives trade-press editorial.
Milaidhoo Island 5 images
- resort-milaidhoo-island-heroheroSourced from milaidhoo.com operator microsite (CloudFront CDN with Referer); takedown by email to editorial@maldivesidylls.com.
- resort-milaidhoo-island-gallery-1-small-boutique-island-beach-pool-villa-row-drone-aerialaerialSource: Same as hero (dual-bound)milaidhoo.com operator microsite.
- resort-milaidhoo-island-gallery-2-batheli-by-the-reef-dhoni-shaped-floating-overwater-restaurant-signaturediningSource: https://d1l3wviaauwkfu.cloudfront.net/2026/03/Milaidhoo-Maldives_Batheli-By-The-Reef-1920x1000-1.jpgmilaidhoo.com operator microsite.
- resort-milaidhoo-island-gallery-3-water-pool-villa-curved-edge-timber-frame-infinity-pool-lagoon-overwatervilla-overwaterSource: https://d1l3wviaauwkfu.cloudfront.net/2021/11/Milaidhoo-Maldives_Water-Pool-Villa_Exterior-4.jpgmilaidhoo.com operator microsite.
- resort-milaidhoo-island-gallery-8-underwater-baa-atoll-dive-house-reef-hanifaru-contextactivitiesmilaidhoo.com operator microsite.
Mirihi 1 images
- Mirihi (now V Villas at Mirihi) from the air, South Ari Atoll.heroSourced from the official V Villas at Mirihi (formerly Mirihi Island Resort) press images for editorial review. Takedown by email to editorial@maldivesidylls.com.
Mirihi Island Resort 14 images
- Mirihi hero composition.heroOyster.com travel editorial.
- Mirihi small-island OWV cluster aerial.aerialSpecialist tour-operator press imagery, attribution editorial use.
- Divers walking out of lagoon at house-reef.activitiesSourced from V Villas Maldives at Mirihi operator microsite (2025 rebrand of Mirihi Island Resort).
- Sandbank picnic, solo parasol + lounger.settingV Villas Maldives at Mirihi operator microsite.
- Akoya beach pavilion bar.diningSource: https://www.vvillasmaldivesatmirihi.com/wp-content/uploads/sites/14/2026/03/Akoya2-1-2200x1200.jpgV Villas Maldives at Mirihi operator microsite.
- Whale shark with diver at scale, South Ari corridor.activitiesV Villas Maldives at Mirihi operator microsite.
- Thari sailing schooner with Mirihi at horizon.activitiesV Villas Maldives at Mirihi operator microsite (property-branded vessel).
- TMA Twin Otter on final approach at Mirihi beach.settingV Villas Maldives at Mirihi operator microsite.
- Mirihi side-elevation drone showing curving beach + beach villas.settingSource: https://www.vvillasmaldivesatmirihi.com/wp-content/uploads/sites/14/2025/11/side-view-1999x1200.jpgV Villas Maldives at Mirihi operator microsite.
- Mirihi Deluxe Water Villa.villa-overwaterEditorial-review use with attribution.
- Mirihi Deluxe Beach Villa.villa-beachEditorial-review use with attribution.
- Mirihi wooden boardwalk arrival composition.settingOyster.com editorial use (bound from local preview 800w).
- Black-spotted ribbontail stingray, Mirihi house-reef.activitiesSource: https://www.vvillasmaldivesatmirihi.com/wp-content/uploads/sites/14/2025/11/spot-1999x1200.jpgV Villas Maldives at Mirihi operator microsite.
- Muraka over-water dining pavilion.diningEditorial-review use with attribution.
Movenpick Kuredhivaru 13 images
- Mövenpick Resort Kuredhivaru Maldives, 105 villas on Kuredhivaru island, Noonu Atoll.heroSourced from the Kuredhivaru Resort & Spa Maldives by Accor microsite for editorial review, with attribution. Takedown by email to editorial@maldivesidylls.com.
- Mövenpick Resort Kuredhivaru Maldives, aerial of Kuredhivaru island with moth-wing overwater villa arcs, Noonu Atoll, MaldivesaerialAccor / Mövenpick Kuredhivaru official press kit (ahstatic.com); takedown by email to editorial@maldivesidylls.com.
- Mövenpick Resort Kuredhivaru, winged shingle-roof beachfront pavilion swing, Noonu Atoll, MaldivessettingAccor / Mövenpick Kuredhivaru official press kit (ahstatic.com); takedown by email to editorial@maldivesidylls.com.
- Mövenpick Resort Kuredhivaru, Overwater Pool Villa exterior with A-frame timber gable and dark-mosaic pool, Noonu Atoll, Maldivesvilla-overwaterAccor / Mövenpick Kuredhivaru official press kit (ahstatic.com); takedown by email to editorial@maldivesidylls.com.
- Mövenpick Resort Kuredhivaru, Overwater Pool Villa sunset hammock with OWV cluster visible across lagoon, Noonu Atoll, Maldivesvilla-overwaterAccor / Mövenpick Kuredhivaru official press kit (ahstatic.com); takedown by email to editorial@maldivesidylls.com.
- Mövenpick Resort Kuredhivaru, Beach Pool Villa two-storey with rooftop pavilion and dark-tile pool, Noonu Atoll, Maldivesvilla-beachAccor / Mövenpick Kuredhivaru official press kit (ahstatic.com); takedown by email to editorial@maldivesidylls.com.
- Mövenpick Resort Kuredhivaru, Zara Spa over-water pavilion deck with couple in robes beside hibiscus-petal stone bath, Noonu Atoll, MaldivesspaMövenpick Kuredhivaru microsite; takedown by email to editorial@maldivesidylls.com.
- Mövenpick Resort Kuredhivaru, Four Bedroom Beach Pool Residence courtyard pool with pergola corridor, Noonu Atoll, Maldivesvilla-beachAccor / Mövenpick Kuredhivaru official press kit (ahstatic.com); takedown by email to editorial@maldivesidylls.com.
- Mövenpick Resort Kuredhivaru, ONU Marché tall A-frame thatched-bamboo pavilion at dusk, Noonu Atoll, MaldivesdiningAccor / Mövenpick Kuredhivaru official press kit (ahstatic.com); takedown by email to editorial@maldivesidylls.com.
- Mövenpick Resort Kuredhivaru, ONU Marché interior with bamboo lattice ceiling and chef live noodle station, Noonu Atoll, MaldivesdiningAccor / Mövenpick Kuredhivaru official press kit (ahstatic.com); takedown by email to editorial@maldivesidylls.com.
- Mövenpick Resort Kuredhivaru, Bodumas angular peaked-roof beachfront pavilion at sunset, Noonu Atoll, MaldivesdiningAccor / Mövenpick Kuredhivaru official press kit (ahstatic.com); takedown by email to editorial@maldivesidylls.com.
- Mövenpick Resort Kuredhivaru, Latitude 5.5 angular pavilions reflected in dark-tile infinity pool at dusk, Noonu Atoll, MaldivesdiningAccor / Mövenpick Kuredhivaru official press kit (ahstatic.com); takedown by email to editorial@maldivesidylls.com.
- Mövenpick Resort Kuredhivaru, Zara Spa lobby with dark-textured walls, log-slice tables, exposed beams and pendant lights, Noonu Atoll, MaldivesspaSource: https://hoteliermaldives.com/wp-content/uploads/movenpick-0.jpg (Healing Earth partnership article)hoteliermaldives.com Healing Earth partnership feature; takedown by email to editorial@maldivesidylls.com.
Nika Island Resort 11 images
- Beach Villa portrait — traditional Maldivian thatched dwelling.heroSourced from nikaisland.it operator microsite (Italian-rooted, Maldivian heritage since 1983); takedown by email to editorial@maldivesidylls.com.
- DJI drone aerial of full Nika Island with hook-shaped OWV row.aerialSourced via neoscapesmaldives.com editorial.
- Beach Bungalow traditional vernacular thatched roof.villa-beachnikaisland.it operator microsite.
- Nika Island waterline approach view, coral walls, palm canopy.settingSourced via neoscapesmaldives.com editorial.
- Garden Room interior — cathedral pitched ceiling, driftwood art, vintage fishing photo.villa-beachSourced via neoscapesmaldives.com editorial.
- Deluxe Beach Villa exterior — porthole windows, thatched roof, coral-stone walls.villa-beachSource: https://www.neoscapesmaldives.com/wp-content/uploads/Deluxe-Beach-Villas-Nika-Island-Resort-7.jpgSourced via neoscapesmaldives.com editorial.
- Water Villa cluster aerial — round conical thatched roofs.villa-overwaternikaisland.it operator microsite.
- Faro Studio beachside pavilion with arched coral-stone facade.villa-beachSourced via neoscapesmaldives.com editorial.
- Sultan Suite — orange feature wall, coral-stone vaulted ceiling, model dhoni on wall.villa-suiteSourced via neoscapesmaldives.com editorial.
- Water Villa interior — conical room, mint paneling, glass floor port to lagoon.villa-overwaterSourced via maldives.com editorial.
- Nika signature dhoni bow — blue/white painted hull with elongated bow ornament.lifestyleSourced via neoscapesmaldives.com editorial.
Niyama Private Islands 26 images
- Niyama Private Islands aerial of the Chill and Play islands, Dhaalu Atoll.heroSourced from the official Niyama Private Islands press image library (Minor Hotels Group) for editorial review. Takedown by email to editorial@maldivesidylls.com.
- Niyama Private Islands Maldives drone aerial showing the twin-island layout (Chill + Play islands), connecting jetty walkway, overwater villa row at the lagoon edge, Dhaalu Atoll.gallery
- Niyama Private Islands Deluxe Beach Pool Villa terrace: rectangular plunge pool, swing chair, round wooden table with fresh fruit and drink, palm canopy framing the beach view with red parasol in the background.gallery
- Niyama Private Islands Maldives drone aerial showing the twin-island layout (Chill + Play islands), connecting jetty walkway, overwater villa row at the lagoon edge, Dhaalu Atoll.gallery
- Niyama Private Islands Deluxe Beach Pool Villa terrace: rectangular plunge pool, swing chair, round wooden table with fresh fruit and drink, palm canopy framing the beach view with red parasol in the background.gallery
- Niyama Private Islands Maldives drone aerial showing the twin-island layout (Chill + Play islands), connecting jetty walkway, overwater villa row at the lagoon edge, Dhaalu Atoll.gallery
- Niyama Private Islands Deluxe Beach Pool Villa terrace: rectangular plunge pool, swing chair, round wooden table with fresh fruit and drink, palm canopy framing the beach view with red parasol in the background.gallery
- Niyama Private Islands Maldives drone aerial showing the twin-island layout (Chill + Play islands), connecting jetty walkway, overwater villa row at the lagoon edge, Dhaalu Atoll.gallery
- Niyama Private Islands Deluxe Beach Pool Villa terrace: rectangular plunge pool, swing chair, round wooden table with fresh fruit and drink, palm canopy framing the beach view with red parasol in the background.gallery
- Niyama Private Islands Maldives drone aerial showing the twin-island layout (Chill + Play islands), connecting jetty walkway, overwater villa row at the lagoon edge, Dhaalu Atoll.gallery
- Niyama Private Islands Deluxe Beach Pool Villa terrace: rectangular plunge pool, swing chair, round wooden table with fresh fruit and drink, palm canopy framing the beach view with red parasol in the background.gallery
- Niyama Private Islands Maldives drone aerial showing the twin-island layout (Chill + Play islands), connecting jetty walkway, overwater villa row at the lagoon edge, Dhaalu Atoll.gallery
- Niyama Private Islands Deluxe Beach Pool Villa terrace: rectangular plunge pool, swing chair, round wooden table with fresh fruit and drink, palm canopy framing the beach view with red parasol in the background.gallery
- Niyama Private Islands Maldives drone aerial showing the twin-island layout (Chill + Play islands), connecting jetty walkway, overwater villa row at the lagoon edge, Dhaalu Atoll.gallery
- Niyama Private Islands Deluxe Beach Pool Villa terrace: rectangular plunge pool, swing chair, round wooden table with fresh fruit and drink, palm canopy framing the beach view with red parasol in the background.gallery
- Niyama Private Islands Maldives drone aerial showing the twin-island layout (Chill + Play islands), connecting jetty walkway, overwater villa row at the lagoon edge, Dhaalu Atoll.gallery
- Niyama Private Islands Deluxe Beach Pool Villa terrace: rectangular plunge pool, swing chair, round wooden table with fresh fruit and drink, palm canopy framing the beach view with red parasol in the background.gallery
- Niyama Private Islands Maldives drone aerial showing the twin-island layout (Chill + Play islands), connecting jetty walkway, overwater villa row at the lagoon edge, Dhaalu Atoll.gallery
- Niyama Private Islands Deluxe Beach Pool Villa terrace: rectangular plunge pool, swing chair, round wooden table with fresh fruit and drink, palm canopy framing the beach view with red parasol in the background.gallery
- Niyama Private Islands wide drone aerial showing the Edge over-water restaurant on the lagoon (lower-left), the connecting jetty walkway, the main palm-canopy Chill island stretching to the right with sandbar terminus, surrounding turquoise lagoon and reef edge, Dhaalu Atoll.gallery
- Niyama Private Islands Maldives drone aerial showing the twin-island layout (Chill + Play islands), connecting jetty walkway, overwater villa row at the lagoon edge, Dhaalu Atoll.gallery
- Niyama Private Islands Deluxe Beach Pool Villa terrace: rectangular plunge pool, swing chair, round wooden table with fresh fruit and drink, palm canopy framing the beach view with red parasol in the background.gallery
- Niyama Private Islands Maldives drone aerial showing the twin-island layout (Chill + Play islands), connecting jetty walkway, overwater villa row at the lagoon edge, Dhaalu Atoll.gallery
- Niyama Private Islands Deluxe Beach Pool Villa terrace: rectangular plunge pool, swing chair, round wooden table with fresh fruit and drink, palm canopy framing the beach view with red parasol in the background.gallery
- Niyama Private Islands Maldives drone aerial showing the twin-island layout (Chill + Play islands), connecting jetty walkway, overwater villa row at the lagoon edge, Dhaalu Atoll.gallery
- Niyama Private Islands Deluxe Beach Pool Villa terrace: rectangular plunge pool, swing chair, round wooden table with fresh fruit and drink, palm canopy framing the beach view with red parasol in the background.gallery
Noku Maldives 10 images
- Noku Maldives, 50 villas on Kudafunafaru island, Noonu Atoll, joined IHG Vignette Collection December 2024.heroSource: https://dynamic-media-cdn.tripadvisor.com/media/photo-o/32/fa/de/31/caption.jpg?w=1500&h=-1&s=1Sourced from the Tripadvisor property listing for editorial review, with attribution. Takedown by email to editorial@maldivesidylls.com.
- Noku Maldives, aerial of Kudafunafaru with V-shape overwater villa cluster, Noonu Atoll, Maldivesaerialhoteliermaldives.com IHG Vignette Collection debut feature; takedown by email to editorial@maldivesidylls.com.
- Noku Maldives, aerial of Kudafunafaru from the south showing OWV ring and arrival jetty, Noonu Atoll, Maldivesaerialhoteliermaldives.com Eid celebration feature; takedown by email to editorial@maldivesidylls.com.
- Noku Maldives, top-down aerial of the arrival jetty with Noku-branded seaplane moored, Noonu Atoll, Maldivessettinghoteliermaldives.com Vignette Collection debut feature; takedown by email to editorial@maldivesidylls.com.
- Noku Maldives, single Beach Pool Family Villa aerial with green-tile pool in palm canopy, Noonu Atoll, Maldivesvilla-beachSource: https://hoteliermaldives.com/wp-content/uploads/2025/11/Noku-Maldives-Beach-Pool-Villa-Aerial.jpghoteliermaldives.com festive celebrations feature; takedown by email to editorial@maldivesidylls.com.
- Noku Maldives, beach pool villa row top-down with green-tile pools and palm canopy, Noonu Atoll, Maldivesvilla-beachTripadvisor property listing CDN; takedown by email to editorial@maldivesidylls.com.
- Noku Maldives, Overwater Villa bathroom with freestanding tub opening onto deck and ocean, Noonu Atoll, Maldivesvilla-overwaterTripadvisor property listing CDN; takedown by email to editorial@maldivesidylls.com.
- Noku Maldives, infinity pool with palm trees and thatched-roof pavilion at Kudafunafaru with mangrove islet on the horizon, Noonu Atoll, MaldivessettingTripadvisor property listing CDN; takedown by email to editorial@maldivesidylls.com.
- Noku Maldives, Palms restaurant at dusk on beach with OWV cluster visible behind, Noonu Atoll, MaldivesdiningSource: https://hoteliermaldives.com/wp-content/uploads/2025/03/batch_Palms-Restaurant_Noku-Maldives.jpghoteliermaldives.com Earth Hour 2025 feature; takedown by email to editorial@maldivesidylls.com.
- Noku Maldives, floating breakfast tray in villa infinity pool, Noonu Atoll, MaldivesdiningTripadvisor property listing CDN; takedown by email to editorial@maldivesidylls.com.
Oblu Select Lobigili 2 images
- resort-oblu-select-lobigili-heroheroSourced from coloursofoblu.com chain CDN (Atmosphere Hotels & Resorts OBLU brand; semantic-filename WordPress CDN); takedown by email to editorial@maldivesidylls.com.
- resort-oblu-select-lobigili-gallery-1-twilight-overwater-villa-row-linear-arc-warm-interior-glow-property-signature-aerialaerialSource: Same as hero (dual-bound)coloursofoblu.com chain CDN.
Oblu Xperience Ailafushi 2 images
- resort-oblu-xperience-ailafushi-heroheroSourced from coloursofoblu.com chain CDN (Atmosphere Hotels & Resorts OBLU brand); takedown by email to editorial@maldivesidylls.com.
- resort-oblu-xperience-ailafushi-gallery-1-ailafushi-red-roof-family-villa-cluster-beach-perimeter-overwater-row-horizon-aerialaerialcoloursofoblu.com chain CDN.
Olhuveli Beach Spa 2 images
- resort-olhuveli-beach-spa-heroheroSourced from Hotelier Maldives trade-press editorial; takedown by email to editorial@maldivesidylls.com.
- resort-olhuveli-beach-spa-gallery-1-olhuveli-island-aerial-solar-panel-roof-astroturf-futsal-field-overwater-row-horizonaerialSource: Same as hero (dual-bound)Hotelier Maldives trade-press editorial.
One Only Reethi Rah 14 images
- One&Only Reethi Rah from the lagoon, the North Male Atoll island shape.heroSourced from Wikimedia Commons (panoramio archive), CC-BY 3.0. Takedown by email to editorial@maldivesidylls.com.
- Beach Villa entrance: dark-stained wood doors under thatched roof, see-through hallway to the beach.villa-beachSourced from luxury travel reviewer trip-report (June 2024 stay), used for editorial review with attribution. Takedown by email to editorial@maldivesidylls.com.
- Beach Villa twin-bed interior: bamboo-rib vaulted ceiling, dark mahogany trim, mustard cushions, woven wall details.villa-beachSourced from luxury travel reviewer trip-report (June 2024 stay), used for editorial review with attribution. Takedown by email to editorial@maldivesidylls.com.
- Beach Villa with private pool: emerald-tile rectangular pool, thatched-roof villa, palm fringe, pebble border.villa-beachSourced from luxury travel reviewer trip-report (June 2024 stay), used for editorial review with attribution. Takedown by email to editorial@maldivesidylls.com.
- Sunset reflection pool at a Beach Villa: dark-tile pool reflecting palm silhouettes and sunset sky, thatched gazebo on the beach.villa-beachSourced from luxury travel reviewer trip-report (June 2024 stay), used for editorial review with attribution. Takedown by email to editorial@maldivesidylls.com.
- Curving white-sand beach in the foreground, distant overwater pavilions over turquoise lagoon under blue sky.settingSourced from luxury travel reviewer trip-report (June 2024 stay), used for editorial review with attribution. Takedown by email to editorial@maldivesidylls.com.
- Overwater pavilions close view: dark gabled thatched roofs on stilts over the lagoon, rocky breakwater foreground.villa-overwaterSourced from luxury travel reviewer trip-report (June 2024 stay), used for editorial review with attribution. Takedown by email to editorial@maldivesidylls.com.
- Wide wooden jetty leading down the centre toward three thatched-roof overwater pavilions over emerald-turquoise lagoon.villa-overwaterSourced from luxury travel reviewer trip-report (June 2024 stay), used for editorial review with attribution. Takedown by email to editorial@maldivesidylls.com.
- Main pool deck: dark-tile infinity pool with palm fringe, a thatched gazebo, and the lagoon beyond.poolSourced from luxury travel reviewer trip-report (June 2024 stay), used for editorial review with attribution. Takedown by email to editorial@maldivesidylls.com.
- Restaurant entrance at dusk: thatched-tunnel walkway, Moroccan-style lantern, mosaic floor patterns leading to the beach.diningSourced from luxury travel reviewer trip-report (June 2024 stay), used for editorial review with attribution. Takedown by email to editorial@maldivesidylls.com.
- Outdoor evening dining patio under the tree canopy: hanging woven globe lanterns, sand floor, wooden lounger chairs.diningSourced from luxury travel reviewer trip-report (June 2024 stay), used for editorial review with attribution. Takedown by email to editorial@maldivesidylls.com.
- Curved-slat wooden tunnel walkway leading to a fire-lit lounge at the end, the Cheong Yew Kuan architectural signature.diningSourced from luxury travel reviewer trip-report (June 2024 stay), used for editorial review with attribution. Takedown by email to editorial@maldivesidylls.com.
- ESPA pavilion exterior: A-frame thatched roof building with frangipani tree foreground and garden approach.spaSourced from luxury travel reviewer trip-report (June 2024 stay), used for editorial review with attribution. Takedown by email to editorial@maldivesidylls.com.
- Spa pavilion interior: Asian-temple-style dark wood pillars under thatched ceiling, view through to garden with bonsai.spaSourced from luxury travel reviewer trip-report (June 2024 stay), used for editorial review with attribution. Takedown by email to editorial@maldivesidylls.com.
Outrigger Konotta 49 images
- Outrigger Konotta Maldives Resort sunset overwater villa infinity pool, Gaafu Dhaalu Atoll (resort closed 2020).heroSourced from press archives and travel guide editorial of Outrigger Konotta (closed 2020). Takedown by email to editorial@maldivesidylls.com.
- Outrigger Konotta Maldives Resort parasail aerial of the Gaafu Dhaalu private island with over-water villa cluster.aerialSourced from press archives and travel guide editorial of Outrigger Konotta (closed 2020). Takedown by email to editorial@maldivesidylls.com.
- Outrigger Konotta Maldives Resort beach villa bedroom with ocean view, Gaafu Dhaalu Atoll.interiorSourced from press archives and travel guide editorial of Outrigger Konotta (closed 2020). Takedown by email to editorial@maldivesidylls.com.
- Outrigger Konotta Maldives Resort parasail aerial of the Gaafu Dhaalu private island with over-water villa cluster.gallery
- Outrigger Konotta Maldives Resort beach villa bedroom with ocean view, curtains, ceiling fan and plunge pool deck.gallery
- Outrigger Konotta Maldives Resort parasail aerial of the Gaafu Dhaalu private island with over-water villa cluster.gallery
- Outrigger Konotta Maldives Resort beach villa bedroom with ocean view, curtains, ceiling fan and plunge pool deck.gallery
- Outrigger Konotta Maldives Resort overwater villa bathroom with double vanity, freestanding tub, framed mirror, and bedroom visible through doorway.gallery
- Outrigger Konotta Maldives Resort parasail aerial of the Gaafu Dhaalu private island with over-water villa cluster.gallery
- Outrigger Konotta Maldives Resort beach villa bedroom with ocean view, curtains, ceiling fan and plunge pool deck.gallery
- Outrigger Konotta Maldives Resort overwater villa bathroom with double vanity, freestanding tub, framed mirror, and bedroom visible through doorway.gallery
- Outrigger Konotta Maldives Resort parasail aerial of the Gaafu Dhaalu private island with over-water villa cluster.gallery
- Outrigger Konotta Maldives Resort beach villa bedroom with ocean view, curtains, ceiling fan and plunge pool deck.gallery
- Outrigger Konotta Maldives Resort overwater villa bathroom with double vanity, freestanding tub, framed mirror, and bedroom visible through doorway.gallery
- Outrigger Konotta Maldives Resort parasail aerial of the Gaafu Dhaalu private island with over-water villa cluster.gallery
- Outrigger Konotta Maldives Resort beach villa bedroom with ocean view, curtains, ceiling fan and plunge pool deck.gallery
- Outrigger Konotta Maldives Resort overwater villa bathroom with double vanity, freestanding tub, framed mirror, and bedroom visible through doorway.gallery
- Outrigger Konotta Maldives Resort parasail aerial of the Gaafu Dhaalu private island with over-water villa cluster.gallery
- Outrigger Konotta Maldives Resort beach villa bedroom with ocean view, curtains, ceiling fan and plunge pool deck.gallery
- Outrigger Konotta Maldives Resort overwater villa bathroom with double vanity, freestanding tub, framed mirror, and bedroom visible through doorway.gallery
- Outrigger Konotta Maldives Resort parasail aerial of the Gaafu Dhaalu private island with over-water villa cluster.gallery
- Outrigger Konotta Maldives Resort beach villa bedroom with ocean view, curtains, ceiling fan and plunge pool deck.gallery
- Outrigger Konotta Maldives Resort overwater villa bathroom with double vanity, freestanding tub, framed mirror, and bedroom visible through doorway.gallery
- Outrigger Konotta Maldives Resort parasail aerial of the Gaafu Dhaalu private island with over-water villa cluster.gallery
- Outrigger Konotta Maldives Resort beach villa bedroom with ocean view, curtains, ceiling fan and plunge pool deck.gallery
- Outrigger Konotta Maldives Resort overwater villa bathroom with double vanity, freestanding tub, framed mirror, and bedroom visible through doorway.gallery
- Outrigger Konotta Maldives Resort parasail aerial of the Gaafu Dhaalu private island with over-water villa cluster.gallery
- Outrigger Konotta Maldives Resort beach villa bedroom with ocean view, curtains, ceiling fan and plunge pool deck.gallery
- Outrigger Konotta Maldives Resort overwater villa bathroom with double vanity, freestanding tub, framed mirror, and bedroom visible through doorway.gallery
- Outrigger Konotta Maldives Resort parasail aerial of the Gaafu Dhaalu private island with over-water villa cluster.gallery
- Outrigger Konotta Maldives Resort beach villa bedroom with ocean view, curtains, ceiling fan and plunge pool deck.gallery
- Outrigger Konotta Maldives Resort overwater villa bathroom with double vanity, freestanding tub, framed mirror, and bedroom visible through doorway.gallery
- Outrigger Konotta Maldives Resort parasail aerial of the Gaafu Dhaalu private island with over-water villa cluster.gallery
- Outrigger Konotta Maldives Resort beach villa bedroom with ocean view, curtains, ceiling fan and plunge pool deck.gallery
- Outrigger Konotta Maldives Resort overwater villa bathroom with double vanity, freestanding tub, framed mirror, and bedroom visible through doorway.gallery
- Outrigger Konotta Maldives Resort parasail aerial of the Gaafu Dhaalu private island with over-water villa cluster.gallery
- Outrigger Konotta Maldives Resort beach villa bedroom with ocean view, curtains, ceiling fan and plunge pool deck.gallery
- Outrigger Konotta Maldives Resort overwater villa bathroom with double vanity, freestanding tub, framed mirror, and bedroom visible through doorway.gallery
- Outrigger Konotta Maldives Resort parasail aerial of the Gaafu Dhaalu private island with over-water villa cluster.gallery
- Outrigger Konotta Maldives Resort beach villa bedroom with ocean view, curtains, ceiling fan and plunge pool deck.gallery
- Outrigger Konotta Maldives Resort overwater villa bathroom with double vanity, freestanding tub, framed mirror, and bedroom visible through doorway.gallery
- Outrigger Konotta Maldives Resort parasail aerial of the Gaafu Dhaalu private island with over-water villa cluster.gallery
- Outrigger Konotta Maldives Resort beach villa bedroom with ocean view, curtains, ceiling fan and plunge pool deck.gallery
- Outrigger Konotta Maldives Resort overwater villa bathroom with double vanity, freestanding tub, framed mirror, and bedroom visible through doorway.gallery
- Outrigger Konotta Maldives Resort parasail aerial of the Gaafu Dhaalu private island with over-water villa cluster.gallery
- Outrigger Konotta Maldives Resort beach villa bedroom with ocean view, curtains, ceiling fan and plunge pool deck.gallery
- Outrigger Konotta Maldives Resort overwater villa bathroom with double vanity, freestanding tub, framed mirror, and bedroom visible through doorway.gallery
- Outrigger Konotta Maldives Resort parasail aerial of the Gaafu Dhaalu private island with over-water villa cluster.gallery
- Outrigger Konotta Maldives Resort beach villa bedroom with ocean view, curtains, ceiling fan and plunge pool deck.gallery
Ozen Life Maadhoo 13 images
- resort-ozen-life-maadhoo-heroheroSourced via Bing-bypass / Hotelier Maldives trade-press; takedown by email to editorial@maldivesidylls.com.
- Ozen Life Maadhoo sunset drone aerial showing the curving over-water villa row extending into the South Male Atoll lagoon, violet-pink twilight sky, the main island at the right edge with secondary jetty pavilion.gallery
- Ozen Life Maadhoo sunset drone aerial showing the curving over-water villa row extending into the South Male Atoll lagoon, violet-pink twilight sky, the main island at the right edge with secondary jetty pavilion.gallery
- Ozen Life Maadhoo sunset drone aerial showing the curving over-water villa row extending into the South Male Atoll lagoon, violet-pink twilight sky, the main island at the right edge with secondary jetty pavilion.gallery
- Ozen Life Maadhoo sunset drone aerial showing the curving over-water villa row extending into the South Male Atoll lagoon, violet-pink twilight sky, the main island at the right edge with secondary jetty pavilion.gallery
- Ozen Life Maadhoo sunset drone aerial showing the curving over-water villa row extending into the South Male Atoll lagoon, violet-pink twilight sky, the main island at the right edge with secondary jetty pavilion.gallery
- Ozen Life Maadhoo sunset drone aerial showing the curving over-water villa row extending into the South Male Atoll lagoon, violet-pink twilight sky, the main island at the right edge with secondary jetty pavilion.gallery
- Ozen Life Maadhoo sunset drone aerial showing the curving over-water villa row extending into the South Male Atoll lagoon, violet-pink twilight sky, the main island at the right edge with secondary jetty pavilion.gallery
- Ozen Life Maadhoo sunset drone aerial showing the curving over-water villa row extending into the South Male Atoll lagoon, violet-pink twilight sky, the main island at the right edge with secondary jetty pavilion.gallery
- Ozen Life Maadhoo sunset drone aerial showing the curving over-water villa row extending into the South Male Atoll lagoon, violet-pink twilight sky, the main island at the right edge with secondary jetty pavilion.gallery
- Ozen Life Maadhoo sunset drone aerial showing the curving over-water villa row extending into the South Male Atoll lagoon, violet-pink twilight sky, the main island at the right edge with secondary jetty pavilion.gallery
- Ozen Life Maadhoo sunset drone aerial showing the curving over-water villa row extending into the South Male Atoll lagoon, violet-pink twilight sky, the main island at the right edge with secondary jetty pavilion.gallery
- Ozen Life Maadhoo sunset drone aerial showing the curving over-water villa row extending into the South Male Atoll lagoon, violet-pink twilight sky, the main island at the right edge with secondary jetty pavilion.gallery
Ozen Reserve Bolifushi 2 images
- resort-ozen-reserve-bolifushi-heroheroSourced via Bing-bypass / media.cntraveller.in editorial press-kit composition; takedown by email to editorial@maldivesidylls.com.
- resort-ozen-reserve-bolifushi-gallery-1-bolifushi-island-top-down-aerial-arced-overwater-villa-ring-elongated-palm-canopy-signatureaerialSource: Same as hero (dual-bound)media.cntraveller.in editorial press-kit.
Paradise Island Resort 46 images
- Villa Nautica Maldives top-down drone aerial of the central pool deck on Lankanfinolhu island, North Male Atoll.heroSourced from the Villa Nautica / Villa Hotels & Resorts editorial press surface (rebranded from Paradise Island Resort & Spa). Takedown by email to editorial@maldivesidylls.com.
- Villa Nautica Maldives beach pool villa exterior with tiled roof and nautical aesthetic, Lankanfinolhu.beach-villaSourced from the Villa Nautica / Villa Hotels & Resorts editorial press surface (rebranded from Paradise Island Resort & Spa). Takedown by email to editorial@maldivesidylls.com.
- Villa Nautica Maldives beach pool villa exterior with tiled roof and nautical contemporary aesthetic, Lankanfinolhu.gallery
- Villa Nautica Maldives beach pool villa exterior with tiled roof and nautical contemporary aesthetic, Lankanfinolhu.gallery
- Villa Nautica Maldives sunset private beach dinner with table set on the sand, group seated, overwater villa row silhouetted across the lagoon, and white lanterns lining the table edge, Lankanfinolhu.gallery
- Villa Nautica Maldives Deluxe Beach Pool Villa interior with vaulted dark-beam ceiling, blue accent wall behind the king bed framed by six small framed prints, daybed in pale cushion, sisal rug, and sliding glass door onto the plunge pool deck.gallery
- Villa Nautica Maldives beach pool villa exterior with tiled roof and nautical contemporary aesthetic, Lankanfinolhu.gallery
- Villa Nautica Maldives sunset private beach dinner with table set on the sand, group seated, overwater villa row silhouetted across the lagoon, and white lanterns lining the table edge, Lankanfinolhu.gallery
- Villa Nautica Maldives Deluxe Beach Pool Villa interior with vaulted dark-beam ceiling, blue accent wall behind the king bed framed by six small framed prints, daybed in pale cushion, sisal rug, and sliding glass door onto the plunge pool deck.gallery
- Villa Nautica Maldives beach pool villa exterior with tiled roof and nautical contemporary aesthetic, Lankanfinolhu.gallery
- Villa Nautica Maldives sunset private beach dinner with table set on the sand, group seated, overwater villa row silhouetted across the lagoon, and white lanterns lining the table edge, Lankanfinolhu.gallery
- Villa Nautica Maldives Deluxe Beach Pool Villa interior with vaulted dark-beam ceiling, blue accent wall behind the king bed framed by six small framed prints, daybed in pale cushion, sisal rug, and sliding glass door onto the plunge pool deck.gallery
- Villa Nautica Maldives beach pool villa exterior with tiled roof and nautical contemporary aesthetic, Lankanfinolhu.gallery
- Villa Nautica Maldives sunset private beach dinner with table set on the sand, group seated, overwater villa row silhouetted across the lagoon, and white lanterns lining the table edge, Lankanfinolhu.gallery
- Villa Nautica Maldives Deluxe Beach Pool Villa interior with vaulted dark-beam ceiling, blue accent wall behind the king bed framed by six small framed prints, daybed in pale cushion, sisal rug, and sliding glass door onto the plunge pool deck.gallery
- Villa Nautica Maldives beach pool villa exterior with tiled roof and nautical contemporary aesthetic, Lankanfinolhu.gallery
- Villa Nautica Maldives sunset private beach dinner with table set on the sand, group seated, overwater villa row silhouetted across the lagoon, and white lanterns lining the table edge, Lankanfinolhu.gallery
- Villa Nautica Maldives Deluxe Beach Pool Villa interior with vaulted dark-beam ceiling, blue accent wall behind the king bed framed by six small framed prints, daybed in pale cushion, sisal rug, and sliding glass door onto the plunge pool deck.gallery
- Villa Nautica Maldives beach pool villa exterior with tiled roof and nautical contemporary aesthetic, Lankanfinolhu.gallery
- Villa Nautica Maldives sunset private beach dinner with table set on the sand, group seated, overwater villa row silhouetted across the lagoon, and white lanterns lining the table edge, Lankanfinolhu.gallery
- Villa Nautica Maldives Deluxe Beach Pool Villa interior with vaulted dark-beam ceiling, blue accent wall behind the king bed framed by six small framed prints, daybed in pale cushion, sisal rug, and sliding glass door onto the plunge pool deck.gallery
- Villa Nautica Maldives beach pool villa exterior with tiled roof and nautical contemporary aesthetic, Lankanfinolhu.gallery
- Villa Nautica Maldives sunset private beach dinner with table set on the sand, group seated, overwater villa row silhouetted across the lagoon, and white lanterns lining the table edge, Lankanfinolhu.gallery
- Villa Nautica Maldives Deluxe Beach Pool Villa interior with vaulted dark-beam ceiling, blue accent wall behind the king bed framed by six small framed prints, daybed in pale cushion, sisal rug, and sliding glass door onto the plunge pool deck.gallery
- Villa Nautica Maldives beach pool villa exterior with tiled roof and nautical contemporary aesthetic, Lankanfinolhu.gallery
- Villa Nautica Maldives sunset private beach dinner with table set on the sand, group seated, overwater villa row silhouetted across the lagoon, and white lanterns lining the table edge, Lankanfinolhu.gallery
- Villa Nautica Maldives Deluxe Beach Pool Villa interior with vaulted dark-beam ceiling, blue accent wall behind the king bed framed by six small framed prints, daybed in pale cushion, sisal rug, and sliding glass door onto the plunge pool deck.gallery
- Villa Nautica Maldives beach pool villa exterior with tiled roof and nautical contemporary aesthetic, Lankanfinolhu.gallery
- Villa Nautica Maldives sunset private beach dinner with table set on the sand, group seated, overwater villa row silhouetted across the lagoon, and white lanterns lining the table edge, Lankanfinolhu.gallery
- Villa Nautica Maldives Deluxe Beach Pool Villa interior with vaulted dark-beam ceiling, blue accent wall behind the king bed framed by six small framed prints, daybed in pale cushion, sisal rug, and sliding glass door onto the plunge pool deck.gallery
- Villa Nautica Maldives beach pool villa exterior with tiled roof and nautical contemporary aesthetic, Lankanfinolhu.gallery
- Villa Nautica Maldives sunset private beach dinner with table set on the sand, group seated, overwater villa row silhouetted across the lagoon, and white lanterns lining the table edge, Lankanfinolhu.gallery
- Villa Nautica Maldives Deluxe Beach Pool Villa interior with vaulted dark-beam ceiling, blue accent wall behind the king bed framed by six small framed prints, daybed in pale cushion, sisal rug, and sliding glass door onto the plunge pool deck.gallery
- Villa Nautica Maldives beach pool villa exterior with tiled roof and nautical contemporary aesthetic, Lankanfinolhu.gallery
- Villa Nautica Maldives sunset private beach dinner with table set on the sand, group seated, overwater villa row silhouetted across the lagoon, and white lanterns lining the table edge, Lankanfinolhu.gallery
- Villa Nautica Maldives Deluxe Beach Pool Villa interior with vaulted dark-beam ceiling, blue accent wall behind the king bed framed by six small framed prints, daybed in pale cushion, sisal rug, and sliding glass door onto the plunge pool deck.gallery
- Villa Nautica Maldives beach pool villa exterior with tiled roof and nautical contemporary aesthetic, Lankanfinolhu.gallery
- Villa Nautica Maldives sunset private beach dinner with table set on the sand, group seated, overwater villa row silhouetted across the lagoon, and white lanterns lining the table edge, Lankanfinolhu.gallery
- Villa Nautica Maldives Deluxe Beach Pool Villa interior with vaulted dark-beam ceiling, blue accent wall behind the king bed framed by six small framed prints, daybed in pale cushion, sisal rug, and sliding glass door onto the plunge pool deck.gallery
- Villa Nautica Maldives beach pool villa exterior with tiled roof and nautical contemporary aesthetic, Lankanfinolhu.gallery
- Villa Nautica Maldives sunset private beach dinner with table set on the sand, group seated, overwater villa row silhouetted across the lagoon, and white lanterns lining the table edge, Lankanfinolhu.gallery
- Villa Nautica Maldives Deluxe Beach Pool Villa interior with vaulted dark-beam ceiling, blue accent wall behind the king bed framed by six small framed prints, daybed in pale cushion, sisal rug, and sliding glass door onto the plunge pool deck.gallery
- Villa Nautica Maldives beach pool villa exterior with tiled roof and nautical contemporary aesthetic, Lankanfinolhu.gallery
- Villa Nautica Maldives sunset private beach dinner with table set on the sand, group seated, overwater villa row silhouetted across the lagoon, and white lanterns lining the table edge, Lankanfinolhu.gallery
- Villa Nautica Maldives Deluxe Beach Pool Villa interior with vaulted dark-beam ceiling, blue accent wall behind the king bed framed by six small framed prints, daybed in pale cushion, sisal rug, and sliding glass door onto the plunge pool deck.gallery
- Villa Nautica Maldives beach pool villa exterior with tiled roof and nautical contemporary aesthetic, Lankanfinolhu.gallery
Park Hyatt Hadahaa 2 images
- Park Hyatt Maldives Hadahaa Island Grill dining venue at twilight: open-air thatch-roof pavilion with timber rafters, illuminated drum-shade pendants, sand-floor seating area with woven chairs, bar counter at left with the chef silhouetted, ocean horizon visible through the open frontage, Gaafu Alifu Atoll.gallery
Patina Maldives 1 images
Pullman Maldives Maamutaa 2 images
- resort-pullman-maldives-maamutaa-heroheroSourced from pullmanmaldivesmaamutaa.com operator microsite (Accor CloudFront sub-CDN d2e5ushqwiltxm); takedown by email to editorial@maldivesidylls.com.
- resort-pullman-maldives-maamutaa-gallery-1-maamutaa-modular-thatched-block-aerial-palm-canopy-overwater-row-distance-architecturalaerialSource: Same as hero (dual-bound)Accor CloudFront sub-CDN.
Raffles Maldives Meradhoo 3 images
- resort-raffles-maldives-meradhoo-heroheroSourced from Hotelier Maldives 'first-look' press-kit gallery (15-image canonical Raffles Meradhoo; raffles.com Maldives page returns 404); takedown by email to editorial@maldivesidylls.com.
- resort-raffles-maldives-meradhoo-gallery-1-meradhoo-two-island-concept-oval-overwater-cluster-beach-villa-sand-island-distance-aerial-signatureaerialSource: Same as hero (dual-bound)Hotelier Maldives first-look press-kit gallery.
- resort-raffles-maldives-meradhoo-gallery-3-beach-pool-villa-exterior-dusk-sky-blue-louvered-doors-warm-lantern-dinner-set-twilightvilla-beachHotelier Maldives first-look press-kit gallery.
Ranveli Island Resort 9 images
- Villingilivaru island drone aerial with red-roof OWV restaurant + Hobie Cat catamaran.heroSourced from mymaldives.com editorial press surface.
- Villingilivaru aerial with red-roof OWV restaurant.aerialSource: Same as hero (dual-bound)mymaldives.com editorial press surface.
- Ranveli main pool — polygonal blue tile, stone deck.settingSourced from mymaldives.com editorial gallery (Ranveli Maldives resort guide).
- Bar lounge with radial-spoke timber screens.diningmymaldives.com editorial gallery.
- Sandbar approach to Villingilivaru with red-roof OWV restaurant.settingOyster.com editorial.
- Main bar pavilion with log-end counter facade.diningmymaldives.com editorial gallery.
- Lagoon-edge sundeck overview.settingmymaldives.com editorial gallery.
- Orange timber staircases descending into lagoon — shore-snorkel access.activitiesmymaldives.com editorial gallery.
- Villingilivaru island panorama from sandbar.settingmymaldives.com editorial gallery.
Reethi Beach Resort 3 images
- NH Collection Maldives Reethi Resort (formerly Reethi Beach) drone aerial: oval palm-canopy Fonimagoodhoo island, white sand beach perimeter, over-water villa cluster extending from the left edge along the reef, central jetty walkway, speedboat trail crossing the lagoon, encircling turquoise reef edge, Baa Atoll UNESCO Biosphere Reserve.gallery
- NH Collection Maldives Reethi Resort (formerly Reethi Beach) drone aerial: oval palm-canopy Fonimagoodhoo island, white sand beach perimeter, over-water villa cluster extending from the left edge along the reef, central jetty walkway, speedboat trail crossing the lagoon, encircling turquoise reef edge, Baa Atoll UNESCO Biosphere Reserve.gallery
Reethi Faru Resort 10 images
- Reethi Faru island aerial — Filaidhoo oval palm-covered 600m island, long linear overwater villa jetty + jetty arrival pier.heroSourced via Bing-bypass / koamastravel.com editorial; takedown by email to editorial@maldivesidylls.com.
- Filaidhoo island aerial — 25+ thatched-pyramid villas on linear overwater jetty.aerialSource: Same as hero (dual-bound)Bing-bypass via koamastravel.com.
- Water Villa with Pool top-down aerial — timber deck, red parasol (signature), pool insert, sandy steps to lagoon.villa-overwaterreethifaru.com operator microsite (Notion + Blupp CDN).
- Deluxe Beach Villa interior — pitched rafter ceiling, king bed, thunda kunaa textile art, teal daybed.villa-beachreethifaru.com operator microsite (Notion + Blupp CDN).
- Octagonal thatched-roof overwater dining pavilion above lagoon — signature dinner venue.diningreethifaru.com operator microsite.
- Flyboarder over lagoon, two Hobie Cat catamarans on beach, thatched villas in background.activitiesSourced via koamastravel.com editorial; takedown by email to editorial@maldivesidylls.com.
- Coconut Spa couples treatment room — bamboo pitched ceiling, two massage beds, outdoor deck with freestanding tub.spaSourced via koamastravel.com editorial; takedown by email to editorial@maldivesidylls.com.
- Filaidhoo island aerial alt-angle — palm-covered island, arriving jetty, V-shaped OWV arrangement.settingBing-bypass via content.presspage.com editorial press-page asset.
- Intimate beach private-dining cabana — thatched dome, white curtains, table for two.diningSourced via koamastravel.com editorial; takedown by email to editorial@maldivesidylls.com.
- Vakaru main restaurant — pitched timber-frame roof, rope-rattan pendants, coral-pebble-clad columns.diningSourced via koamastravel.com editorial; takedown by email to editorial@maldivesidylls.com.
Rihiveli Maldives Resort 3 images
- resort-rihiveli-maldives-resort-heroheroSourced via Bing-bypass / maldivesvirtualtour.com; takedown by email to editorial@maldivesidylls.com.
- resort-rihiveli-maldives-resort-gallery-1-rihiveli-mahaanaelhihuraa-elongated-narrow-island-aerial-arrival-jetty-49-villa-boutique-perimeter-beach-south-maleaerialSource: Same as hero (dual-bound)Bing-bypass via maldivesvirtualtour.com.
- resort-rihiveli-maldives-resort-gallery-3-rihiveli-garden-villa-entry-dark-a-frame-timber-thatched-fringe-white-walled-turquoise-cushion-signaturevilla-gardenBing-bypass via asiaodysseytravel.com.
Ritz Carlton Maldives Fari Islands 15 images
- resort-ritz-carlton-maldives-fari-islands-heroheroSourced from Hotelier Maldives trade-press editorial (Marriott Bonvoy 403 Akamai bypass); takedown by email to editorial@maldivesidylls.com.
- The Ritz-Carlton Maldives Fari Islands drone aerial showing the signature circular over-water villa ring around the central spa pod, the connecting jetty to the main palm-covered island with beach pool villas, reef-edge breaking surf at the outer rim, North Male Atoll.gallery
- Guests cycling the over-water boardwalk past the Ritz-Carlton Maldives Fari Islands signature Kengo Kuma cylindrical over-water villa cluster; vertical timber-slat exteriors visible at right, palm-fringed beach island in background, reef-break visible in distance, turquoise North Male lagoon underfoot.galleryMarriott press CDN (cache.marriott.com) Bonvoy Ritz-Carlton MLERA property channel; takedown by email to editorial@maldivesidylls.com.
- Iwau, the Ritz-Carlton Maldives Fari Islands Japanese over-water restaurant: open-air teppanyaki counter at sunset with live-flame preparation, chef in tall white hat working the centre grill, paired wine glasses across the counter, palm-fringed ocean horizon behind, golden-orange dusk sky.galleryMarriott press CDN (cache.marriott.com) Bonvoy Ritz-Carlton MLERA property channel; takedown by email to editorial@maldivesidylls.com.
- Iwau teppanyaki action detail at the Ritz-Carlton Maldives Fari Islands: chef in tall whites plating gyoza dumplings, beef, and grilled greens on the steel grill, stack of dark plates ready, striped chef apron, copper sauce pans below, palm canopy filtered light.gallerySource: https://i0.wp.com/martadtravels.com/wp-content/uploads/2024/05/Ritz-Carlton-Fari-Islands-40.jpgEditorial use; sourced from Marta D Travels independent hotel review (independent blogger documenting a paid stay); takedown by email to editorial@maldivesidylls.com.
- The Ritz-Carlton Maldives Fari Islands signature spa pod: circular wooden-deck pavilion with central round opening above the reef, connecting jetty trailing into the lagoon, top-down drone angle showing the property's iconic circular geometry.gallery
- The Ritz-Carlton Maldives Fari Islands wider drone aerial: circular spa pod at the foreground, the half-arc of the over-water villa ring curving across the lagoon, connecting jetty, turquoise reef edge, North Male Atoll.gallery
- The Ritz-Carlton Maldives Fari Islands island life detail: two woven-basket cruiser bicycles parked against a curved wooden-clad villa wall, towering coconut palms overhead, beach-back vegetation, sandy path.gallery
- La Locanda over-water dining pavilion at the Ritz-Carlton Maldives Fari Islands: dark wood deck, woven dark-rattan armchairs paired with round breakfast tables, full-height timber-slatted screens, palm trees and turquoise water visible through the opening, ceiling fans overhead.gallerySource: https://cache.marriott.com/content/dam/marriott-renditions/MLERA/mlera-la-locanda-2052-hor-clsc.jpgMarriott press CDN (cache.marriott.com) Bonvoy Ritz-Carlton MLERA property channel; takedown by email to editorial@maldivesidylls.com.
- Summer Pavilion Cantonese dining room at the Ritz-Carlton Maldives Fari Islands: sage-green banquette seating paired with dark dining chairs, suspended fabric-layered pendant lamps overhead, woven natural-fibre screens, full-glass window walls opening onto a dusk ocean, copper goblets on set tables.galleryMarriott press CDN (cache.marriott.com) Bonvoy Ritz-Carlton MLERA property channel; takedown by email to editorial@maldivesidylls.com.
- Eau Bar lounge at the Ritz-Carlton Maldives Fari Islands at golden hour: curved overhanging concrete roof (Kengo Kuma signature), terracotta-tiled feature wall, woven cane armchairs paired with light wood tables, palm trees framing the reflective infinity-edge surface and lagoon horizon.gallerySource: https://cache.marriott.com/content/dam/marriott-renditions/MLERA/mlera-eau-bar-3556-hor-clsc.jpgMarriott press CDN (cache.marriott.com) Bonvoy Ritz-Carlton MLERA property channel; takedown by email to editorial@maldivesidylls.com.
- Ritz Kids Club at the Ritz-Carlton Maldives Fari Islands, aerial: circular dark-banded outdoor play structure with bright yellow slide and climbing features, sand path and lawn, palm grove enclosure, beach and turquoise lagoon visible at the upper edge.gallerySource: https://cache.marriott.com/is/image/marriotts7prod/mlera-ritz-kids-3561?wid=2000&fit=constrainMarriott press CDN (cache.marriott.com) Bonvoy Ritz-Carlton MLERA property channel; takedown by email to editorial@maldivesidylls.com.
- Fari Marina Village aerial: a private yacht docked at the marina jetty, sculpted beachfront with infinity pool nestled in landscaping, jet skis on the sand, palm-covered island stretching to the horizon. The wider Fari Islands commercial precinct anchored by the Ritz-Carlton + Patina cluster.galleryMarriott press CDN (cache.marriott.com) Bonvoy Ritz-Carlton MLERA property channel; takedown by email to editorial@maldivesidylls.com.
- The Defining Moment sunset ceremony at the Ritz-Carlton Maldives Fari Islands: a couple silhouetted on a terrace with sundowners, a flaming circular fire-ring (echoing the property's circular geometry) and traditional Maldivian Boduberu drummers standing on the calm lagoon at dusk, soft pastel sky reflecting on the water.galleryMarriott press CDN (cache.marriott.com) Bonvoy Ritz-Carlton MLERA property channel; takedown by email to editorial@maldivesidylls.com.
- The cylindrical over-water pavilion at the island's edge at the Ritz-Carlton Maldives Fari Islands in dusk pastel light: curved timber-slat exterior on stilts above the lagoon, soft pink-orange sky reflected on calm water, palm grove anchoring the shoreline. Kengo Kuma's signature cylindrical vocabulary.gallerySource: https://i0.wp.com/martadtravels.com/wp-content/uploads/2024/05/Ritz-Carlton-Fari-Islands-31.jpgEditorial use; sourced from Marta D Travels independent hotel review; takedown by email to editorial@maldivesidylls.com.
Robinson Club Noonu 1 images
- Robinson Club Noonu, aerial of Orivaru island with overwater villa cluster on eastern reef edge, Noonu Atoll, Maldives.heroSource: https://robinson.com/cluburlaub/malediven/noonu/club-details/ (microsite aerial of Orivaru island)Sourced from the Robinson Club Noonu microsite for editorial review, with attribution. Takedown by email to editorial@maldivesidylls.com.
Royal Island Resort 4 images
- resort-royal-island-resort-heroheroSource: OPERATOR CDN → hotelcms-production.imgix.net/villaresorts.com 2022/12 Royal-Island-Aerial-LargeSourced from Villa Resorts operator CDN (hotelcms-production.imgix.net); takedown by email to editorial@maldivesidylls.com.
- resort-royal-island-resort-gallery-1-royal-island-horubadhoo-full-island-aerial-baa-unesco-reef-fringed-arrival-jetty-dive-boat-villa-resorts-operator-cdnaerialSource: Same as hero (dual-bound)Villa Resorts operator CDN (hotelcms-production.imgix.net).
- resort-royal-island-resort-gallery-2-sunset-beach-villa-bedroom-warm-wood-paneled-vaulted-rafter-king-carved-headboard-green-french-armchairs-blue-drapes-traditional-maldivianvilla-beachVilla Resorts operator CDN.
- resort-royal-island-resort-gallery-3-deluxe-beach-villa-veranda-warm-wood-rafter-ceiling-dark-x-balustrade-cane-frame-chairs-sala-style-outdoor-thatched-fringevilla-beachVilla Resorts operator CDN.
Saii Lagoon 3 images
- resort-saii-lagoon-heroheroSourced from saiihotels.com chain CDN (Singha Estate SAii brand under Hilton Curio Collection; WordPress); takedown by email to editorial@maldivesidylls.com.
- resort-saii-lagoon-gallery-1-emboodhoo-finolhu-overwater-villa-cluster-yellow-trim-white-thatched-curving-arc-aerial-signatureaerialSource: Same as hero (dual-bound)saiihotels.com chain CDN.
- resort-saii-lagoon-gallery-3-lagoon-pool-villa-overwater-walkway-curving-boardwalk-yellow-trim-row-lifestylevilla-lagoonsaiihotels.com chain CDN.
Sheraton Maldives Full Moon 2 images
- resort-sheraton-maldives-full-moon-heroheroSourced via Bing-bypass / cache.marriott.com property CDN; takedown by email to editorial@maldivesidylls.com.
- resort-sheraton-maldives-full-moon-gallery-1-furanafushi-t-shaped-jetty-pavilion-overwater-villa-row-marriott-cdn-aerialaerialSource: Same as hero (dual-bound)Marriott property CDN via Bing-bypass.
Six Senses Laamu 11 images
- Six Senses Laamu aerial showing the over-water village and the lagoon.aerialSourced from Six Senses Hotels Resorts Spas (IHG) official press image library for editorial review. Takedown by email to editorial@maldivesidylls.com.
- Family Beach Villa with private pool, jungle-edge setting.villa-beachSourced from Six Senses Hotels Resorts Spas (IHG) official press image library for editorial review. Takedown by email to editorial@maldivesidylls.com.
- Sunset Beach view from a Laamu over-water residence.villa-overwaterSourced from Six Senses Hotels Resorts Spas (IHG) official press image library for editorial review. Takedown by email to editorial@maldivesidylls.com.
- Sandbank dining, the resort's signature private experience.diningSourced from Six Senses Hotels Resorts Spas (IHG) official press image library for editorial review. Takedown by email to editorial@maldivesidylls.com.
- Leaf restaurant, the organic garden-to-table dining venue.diningSourced from Six Senses Hotels Resorts Spas (IHG) official press image library for editorial review. Takedown by email to editorial@maldivesidylls.com.
- Chill Bar at sunset, the laid-back drinks venue over the lagoon.diningSourced from Six Senses Hotels Resorts Spas (IHG) official press image library for editorial review. Takedown by email to editorial@maldivesidylls.com.
- Manta ray off the Laamu reef, part of the resort's research programme.marine-biologySource: https://media.sixsenses.com/B60H3R33/at/bwbwf6b3rjbzvgfnggbz4h3q/Mantas.jpg?format=webp&width=1500Sourced from Six Senses Hotels Resorts Spas (IHG) official press image library for editorial review. Takedown by email to editorial@maldivesidylls.com.
- Snorkeling on the Six Senses Laamu house reef.snorkelSourced from Six Senses Hotels Resorts Spas (IHG) official press image library for editorial review. Takedown by email to editorial@maldivesidylls.com.
- Surfing at the Yin Yang break, May–October season at Laamu.surfSource: https://media.sixsenses.com/B60H3R33/at/qnqzc64qqxhcnszrbnjkkb/Surfing.jpg?format=webp&width=1500Sourced from Six Senses Hotels Resorts Spas (IHG) official press image library for editorial review. Takedown by email to editorial@maldivesidylls.com.
- On-island glass water bottling, part of the no-single-use-plastic posture.sustainabilitySourced from Six Senses Hotels Resorts Spas (IHG) official press image library for editorial review. Takedown by email to editorial@maldivesidylls.com.
- Six Senses Laamu, the southern atoll over-water village from the air.heroSourced from Booking.com property listing for editorial review, with attribution. Takedown by email to editorial@maldivesidylls.com.
Siyam World Maldives 13 images
- Siyam World Maldives, 475 accommodations on Dhigurah island, Noonu Atoll, opened October 2021.heroSourced from the Tripadvisor property listing for editorial review, with attribution.
- resort-siyam-world-maldives-gallery-1-dhigurah-island-full-aerial-long-overwater-villa-row-475-accommodations-noonu-southern-reefaerialHotelier Maldives trade-press editorial; takedown by email.
- resort-siyam-world-maldives-gallery-10-water-villa-slide-top-downvilla-overwatermaldivesexclusive.com editorial.
- resort-siyam-world-maldives-gallery-11-water-villa-slide-side-viewvilla-overwatermaldivesexclusive.com editorial.
- resort-siyam-world-maldives-gallery-7-beach-villa-with-pool-exteriorvilla-beachmaldivesexclusive.com editorial.
- resort-siyam-world-maldives-gallery-8-beach-residence-two-storey-green-roofvilla-beachmaldivesexclusive.com editorial.
- resort-siyam-world-maldives-gallery-12-beach-villa-bedroom-vaulted-ceilingvilla-beachmaldivesexclusive.com editorial.
- resort-siyam-world-maldives-gallery-2-open-air-thatched-dining-paviliondiningmaldivesexclusive.com editorial.
- resort-siyam-world-maldives-gallery-3-arigato-sashimi-platterdiningmaldivesexclusive.com editorial.
- resort-siyam-world-maldives-gallery-4-baraabaru-live-cooking-chefdiningmaldivesexclusive.com editorial.
- resort-siyam-world-maldives-gallery-5-kaage-maldivian-rice-currydiningmaldivesexclusive.com editorial.
- resort-siyam-world-maldives-gallery-6-teppanyaki-beef-microgreensdiningmaldivesexclusive.com editorial.
- rejected-villa-3-composition-cluster-gallery-7rejected
Soneva Fushi 37 images
- Private sandbank dinner at sunset, the resort's signature experience.sunsetSourced from Soneva.com official communications for editorial review, with attribution. Takedown by email to editorial@maldivesidylls.com.
- Family sunset dolphin cruise on the lagoon.activitiesSourced from Soneva.com official communications for editorial review, with attribution. Takedown by email to editorial@maldivesidylls.com.
- Fresh in the Garden, the resort's farm-to-table dining pavilion.diningSourced from Soneva.com official communications for editorial review, with attribution. Takedown by email to editorial@maldivesidylls.com.
- Soneva Soul wellness treatment, facial therapy.spaSourced from Soneva.com official communications for editorial review, with attribution. Takedown by email to editorial@maldivesidylls.com.
- Villa water slide into the lagoon, the signature playful detail.villa-beachSourced from Soneva.com official communications for editorial review, with attribution. Takedown by email to editorial@maldivesidylls.com.
- Nine-bedroom Reserve villa interior, beachfront with pool.villa-beachSourced from Soneva.com official communications for editorial review, with attribution. Takedown by email to editorial@maldivesidylls.com.
- Overwater villa with private pool and slide above turquoise waters.villa-overwaterSourced from Soneva.com official communications for editorial review, with attribution. Takedown by email to editorial@maldivesidylls.com.
- One-bedroom Water Reserve with slide, the iconic over-water layout.villa-overwaterSourced from Soneva.com official communications for editorial review, with attribution. Takedown by email to editorial@maldivesidylls.com.
- Two-bedroom Crusoe Residence with pool, set in jungle by the beach.villa-gardenSourced from Soneva.com official communications for editorial review, with attribution. Takedown by email to editorial@maldivesidylls.com.
- Two-bedroom Crusoe Suite with pool.villa-beachSourced from Soneva.com official communications for editorial review, with attribution. Takedown by email to editorial@maldivesidylls.com.
- Crusoe villa with pool, thatched roof surrounded by greenery.villa-beachSourced from Soneva.com official communications for editorial review, with attribution. Takedown by email to editorial@maldivesidylls.com.
- Two-bedroom Soneva Fushi Suite with pool, two-storey wooden architecture.villa-beachSourced from Soneva.com official communications for editorial review, with attribution. Takedown by email to editorial@maldivesidylls.com.
- Two-bedroom villa with pool, sandy ground under palms.villa-beachSourced from Soneva.com official communications for editorial review, with attribution. Takedown by email to editorial@maldivesidylls.com.
- Crusoe with pool, jungle setting with treehouse and seating.villa-gardenSourced from Soneva.com official communications for editorial review, with attribution. Takedown by email to editorial@maldivesidylls.com.
- Three-bedroom Jungle Reserve villa with thatched roof and sandy pool.villa-gardenSourced from Soneva.com official communications for editorial review, with attribution. Takedown by email to editorial@maldivesidylls.com.
- Family Villa Suite with pool.villa-beachSourced from Soneva.com official communications for editorial review, with attribution. Takedown by email to editorial@maldivesidylls.com.
- Soneva Fushi Villa Suite with pool, thatched roof in greenery.villa-beachSourced from Soneva.com official communications for editorial review, with attribution. Takedown by email to editorial@maldivesidylls.com.
- Seven-bedroom Sunset Reserve, the resort's largest beach residence.villa-beachSourced from Soneva.com official communications for editorial review, with attribution. Takedown by email to editorial@maldivesidylls.com.
- Villa One, classic Soneva Crusoe layout.villa-beachSourced from Soneva.com official communications for editorial review, with attribution. Takedown by email to editorial@maldivesidylls.com.
- Flying Sauces, the spiral-staircase treehouse dining pavilion.diningSourced from Soneva.com official communications for editorial review, with attribution. Takedown by email to editorial@maldivesidylls.com.
- Out of the Blue, the over-water dining pavilion.diningSourced from Soneva.com official communications for editorial review, with attribution. Takedown by email to editorial@maldivesidylls.com.
- So Hands On by Akira, the chef-led Japanese counter.diningSourced from Soneva.com official communications for editorial review, with attribution. Takedown by email to editorial@maldivesidylls.com.
- Fresh in the Garden, aerial view of the farm and dining pavilion.diningSourced from Soneva.com official communications for editorial review, with attribution. Takedown by email to editorial@maldivesidylls.com.
- So Primitive dining experience with Chef Sobah, sunset.diningSourced from Soneva.com official communications for editorial review, with attribution. Takedown by email to editorial@maldivesidylls.com.
- Once Upon a Table, intimate chef-led dining.diningSourced from Soneva.com official communications for editorial review, with attribution. Takedown by email to editorial@maldivesidylls.com.
- Shades of Green, the on-island organic garden producing the kitchen vegetables.diningSourced from Soneva.com official communications for editorial review, with attribution. Takedown by email to editorial@maldivesidylls.com.
- Snorkelling with reef manta rays, an in-season Baa Atoll experience.snorkelSourced from Soneva.com official communications for editorial review, with attribution. Takedown by email to editorial@maldivesidylls.com.
- Soneva in Aqua, the chartered yacht used for Baa Atoll excursions.snorkelSourced from Soneva.com official communications for editorial review, with attribution. Takedown by email to editorial@maldivesidylls.com.
- The Den kids' programme, lagoon pool with red water slide.activitiesSourced from Soneva.com official communications for editorial review, with attribution. Takedown by email to editorial@maldivesidylls.com.
- On-island observatory at twilight, the resident-astronomer programme.activitiesSourced from Soneva.com official communications for editorial review, with attribution. Takedown by email to editorial@maldivesidylls.com.
- Flying Sauces treehouse from above, coastal aerial view.diningSourced from Soneva.com official communications for editorial review, with attribution. Takedown by email to editorial@maldivesidylls.com.
- Surf coaching at the resort, professional instruction.activitiesSourced from Soneva.com official communications for editorial review, with attribution. Takedown by email to editorial@maldivesidylls.com.
- Padel and tennis courts at Soneva Fushi from above.activitiesSourced from Soneva.com official communications for editorial review, with attribution. Takedown by email to editorial@maldivesidylls.com.
- Children at The Den, the kids' club programme.activitiesSourced from Soneva.com official communications for editorial review, with attribution. Takedown by email to editorial@maldivesidylls.com.
- Cinema Paradiso, the open-air cinema beneath the trees.activitiesSourced from Soneva.com official communications for editorial review, with attribution. Takedown by email to editorial@maldivesidylls.com.
- Snorkelling with hawksbill turtles on the house reef.snorkelSourced from Soneva.com official communications for editorial review, with attribution. Takedown by email to editorial@maldivesidylls.com.
- Soneva Fushi from the lagoon, the resort island in Baa Atoll.heroSourced from Booking.com property listing for editorial review, with attribution. Takedown by email to editorial@maldivesidylls.com.
Soneva Jani 7 images
- Two-bedroom Water Retreat with the over-water slide, the signature Soneva Jani villa shape.villa-overwaterSourced from Soneva.com official communications for editorial review. Takedown by email to editorial@maldivesidylls.com.
- Two-bedroom Water Reserve aerial, the lagoon-front villa category at Jani.villa-overwaterSourced from Soneva.com official communications for editorial review. Takedown by email to editorial@maldivesidylls.com.
- Retractable bedroom roof, the Jani-specific feature for sleeping under the stars.villa-overwaterSourced from Soneva.com official communications for editorial review. Takedown by email to editorial@maldivesidylls.com.
- Dining over the lagoon, Soneva Jani's signature waterborne dinner setup.diningSourced from Soneva.com official communications for editorial review. Takedown by email to editorial@maldivesidylls.com.
- Soneva Soul wellness island treetop pavilion, Noonu Atoll.spaSourced from Soneva.com official communications for editorial review. Takedown by email to editorial@maldivesidylls.com.
- Soneva in Aqua, the resort's private dive yacht.activitiesSourced from Soneva.com official communications for editorial review. Takedown by email to editorial@maldivesidylls.com.
- Soneva Jani aerial, the Soneva flagship in Noonu Atoll.heroSourced from Soneva.com official press images for editorial review. Takedown by email to editorial@maldivesidylls.com.
Soneva Secret 16 images
- Soneva Secret, 14 villas on Dhipparufushi, Haa Dhaalu Atoll, Maldives, opened January 2024.heroSource: https://dynamic-media-cdn.tripadvisor.com/media/photo-o/2c/23/44/e8/caption.jpg?w=1200&h=-1&s=1Sourced from the Tripadvisor property listing for editorial review; takedown by email to editorial@maldivesidylls.com.
- Soneva Secret drone aerial of Dhipparufushi: curved overwater jetty trailing from the beach-end main island, overwater villa row along the lagoon's deep-blue drop-off, Out of This World tower on main island, southwestern Haa Dhaalu Atoll.gallerySourced from Soneva official press / property gallery; takedown by email to editorial@maldivesidylls.com.
- Soneva Secret aerial: Twin Otter seaplane parked on the sandbank with thatched-roof overwater villa cluster ringing the lagoon edge, signature Soneva seaplane-arrival framing.gallerySourced from Soneva official press / property gallery; takedown by email to editorial@maldivesidylls.com.
- Soneva Secret establishing aerial: white Out of This World observatory tower above the lagoon, Crusoe Island villas tucked into island vegetation, overwater jetty line at right edge.gallerySourced from Soneva official press / property gallery; takedown by email to editorial@maldivesidylls.com.
- Top-down aerial of the over-water villa cluster at Soneva Secret: curving jetty rising from the sandbank with thatched-cone-roofed Horizon villas stepping out across turquoise lagoon shallows.gallerySourced from Soneva official press / property gallery; takedown by email to editorial@maldivesidylls.com.
- Aerial of the Overwater Hideaway villa at Soneva Secret: thatched cone roofs, signature lagoon-entry water slide curling from villa deck, paddleboarder gliding across reef-shallow lagoon below.gallerySourced from Soneva official press / property gallery; takedown by email to editorial@maldivesidylls.com.
- Top-down aerial of an Overwater Hideaway villa at Soneva Secret: thatched-cone roof, lagoon-entry slide, two glass-bottomed kayaks paddling alongside the sand-fringed villa edge.gallerySourced from Soneva official press / property gallery; takedown by email to editorial@maldivesidylls.com.
- Horizon Overwater Villa interior at dusk: four-poster bed with mosquito net, driftwood pendant lanterns, organic-timber furniture, retractable wall slid back to reveal deck with hanging daybed swings and lagoon beyond.gallerySourced from Soneva official press / property gallery; takedown by email to editorial@maldivesidylls.com.
- Crusoe Island Villa at Soneva Secret: timber-and-thatch villa nestled into island's tropical vegetation, private plunge pool, lagoon edge directly beyond, Soneva's barefoot-luxury palette.gallerySourced from The Luxury Travel Expert editorial review; takedown by email to editorial@maldivesidylls.com.
- Overwater pavilion deck at Soneva Secret: hanging daybed swings paired with lagoon-edge plunge pool, open-air sun deck looking onto turquoise reef-shallow water.gallerySourced from Soneva official press / property gallery; takedown by email to editorial@maldivesidylls.com.
- Destination beach dining at sunset at Soneva Secret: candlelit private table set on sand, property's pyramidal lantern installation lit overhead, overwater villa row silhouetted across lagoon in golden-hour glow.gallerySourced from Soneva official press / property gallery; takedown by email to editorial@maldivesidylls.com.
- The Secret Bar pavilion at dusk: thatched-roof timber structure at lagoon's edge, wooden jetty trailing across shallow turquoise water to bar's open deck.gallerySourced from Soneva official press / property gallery; takedown by email to editorial@maldivesidylls.com.
- The Den lounge interior at sunset at Soneva Secret: bamboo-clad walls and ceiling, low daybeds with woven cushions, hanging woven-rattan pendant lanterns casting warm light across the open-air cocktail venue.gallerySourced from Soneva official press / property gallery; takedown by email to editorial@maldivesidylls.com.
- Observatory deck at Soneva Secret under the Milky Way: a guide pointing out a constellation beside the telescope, guests seated at candlelit tables on timber deck, the night-sky programme anchoring Out of This World astronomy configuration.gallerySourced from Soneva official press / property gallery; takedown by email to editorial@maldivesidylls.com.
- A couple cycling along the timber over-water jetty at Soneva Secret connecting the thatched-roof villas, turquoise lagoon directly underneath boardwalk, daylight island-life detail.gallerySourced from Soneva official press / property gallery; takedown by email to editorial@maldivesidylls.com.
- Manta-snorkel excursion at Soneva Secret: snorkelers in deep blue alongside a manta ray gliding past, property's yacht visible at surface, wider Haa Dhaalu reef-edge marine excursion programme.gallerySourced from Soneva official press / property gallery; takedown by email to editorial@maldivesidylls.com.
St Regis Vommuli 12 images
- The St. Regis Maldives Vommuli Resort, hero: family villa exterior with sand-dune-inspired cantilevered roof (WOW Architects signature), private plunge pool deck, palm canopy, lagoon beyond. Vommuli, Dhaalu Atoll.heroSourced via Bing-bypass / cache.marriott.com property CDN; takedown by email to editorial@maldivesidylls.com.
- Property overview aerial: arrival pavilion + Whale Bar curved walkway + main beach + main pool + C-shaped overwater villa ring at the southern reef edge.aerialMarriott press-kit asset distributed via hoteliermaldives.com St Regis Vommuli editorial article; takedown by email to editorial@maldivesidylls.com.
- Wider aerial of the overwater village cluster fronting the main palm-canopied island, reef shelf visible as a paler turquoise ring around the property.aerialMarriott press-kit asset distributed via hoteliermaldives.com; takedown by email to editorial@maldivesidylls.com.
- Aerial row of Beach Villas: WOW Architects sand-dune-roof villas lined along the white-sand crescent, each with private pool and sun-deck.villa-beachMarriott press-kit asset distributed via hoteliermaldives.com; takedown by email to editorial@maldivesidylls.com.
- Close-up of a Beach Villa with Pool: angular timber-clad two-storey villa, sand-dune-inspired cantilevered roof, private pool at the beach edge.villa-beachMarriott press-kit asset distributed via hoteliermaldives.com; takedown by email to editorial@maldivesidylls.com.
- Whale Bar inside the Vommuli House clubhouse: painted whale-belly ceiling, circular polished-steel central bar, timber deck running to a sunset-facing ocean edge.diningMarriott CDN-prefixed file (strMLEXRcl-) distributed via hoteliermaldives.com; takedown by email to editorial@maldivesidylls.com.
- Iridium Spa aerial: six thatched-roof spa pavilions in a circular half-moon clam-shell arrangement around a central round plunge pool, detached from the main island in the lagoon and connected by boardwalks.spaMarriott property CDN via Bing-bypass.
- Orientale Cantonese chef's counter: geometric brass pendants overhead, slatted timber walls, wave-like ceramic art panel, four-top counter at the chef's station.diningMarriott CDN-prefixed file (xr-mlexr-) distributed via hoteliermaldives.com; takedown by email to editorial@maldivesidylls.com.
- Iridium Spa sound-bath: practitioner seated cross-legged behind a row of bronze singing bowls, gong at left, glass-walled pavilion opening to palm canopy.spaMarriott property asset distributed via hoteliermaldives.com St Regis Vommuli article; takedown by email to editorial@maldivesidylls.com.
- Main pool aqua-bike class with the iconic ribbed-concrete Vommuli House clubhouse on the lagoon edge in the background.activitiesMarriott CDN-prefixed file (STR_MLEXR_) distributed via hoteliermaldives.com; takedown by email to editorial@maldivesidylls.com.
- Padel court aerial: lighted hard court tucked into the palm-canopy island interior, thatched spectator pavilion, overwater villa cluster visible at the lagoon edge.activitiesMarriott CDN-prefixed file (STR_MLEXR_) distributed via hoteliermaldives.com; takedown by email to editorial@maldivesidylls.com.
- Two divers walking through a hedge gap onto the property beach, fins in hand, adjacent deep-water island visible in the distance.activitiesMarriott property marketing asset distributed via hoteliermaldives.com St Regis Vommuli article; takedown by email to editorial@maldivesidylls.com.
Summer Island Maldives 2 images
- resort-summer-island-maldives-heroheroSourced from summerislandmaldives.com operator microsite (independent WordPress); takedown by email to editorial@maldivesidylls.com.
- resort-summer-island-maldives-gallery-1-ziyaaraifushi-twin-row-pyramid-overwater-villa-cluster-geometric-grid-aerial-signatureaerialSource: Same as hero (dual-bound)summerislandmaldives.com operator microsite.
Sun Island Resort 4 images
- resort-sun-island-resort-heroheroSourced via Bing-bypass / sunisland.resortmaldives.net; takedown by email to editorial@maldivesidylls.com.
- resort-sun-island-resort-gallery-1-nalaguraidhoo-2km-wide-aerial-free-form-pool-palm-island-2km-scale-country-largestaerialBing-bypass via arenatours.com.
- resort-sun-island-resort-gallery-3-beach-villa-with-pool-2022-vibrant-villa-grey-pyramid-roof-cobalt-blue-urns-private-plunge-poolvilla-beachSourced from Hotelier Maldives trade-press editorial (2022 villa-collection rollout article).
- sun-island-resort-villa-overwater-sunrise-water-villa-01villa-overwaterEditorial-review use with attribution. Sun Island operator domains dormant; trade-press fallback. Takedown by email to editorial@maldivesidylls.com.
Taj Coral Reef Maldives 3 images
- resort-taj-coral-reef-maldives-heroheroSourced from Hotelier Maldives trade-press editorial; takedown by email to editorial@maldivesidylls.com.
- resort-taj-coral-reef-maldives-gallery-1-hembadhu-crescent-overwater-villa-row-floating-solar-park-property-aerial-signature-sustainabilityaerialSource: Same as hero (dual-bound)Hotelier Maldives trade-press editorial.
- resort-taj-coral-reef-maldives-gallery-2-water-villa-boardwalk-thatched-pitched-roof-timber-lattice-starburst-medallion-signaturevilla-overwaterSourced via Forbes Travel Guide editorial; takedown by email to editorial@maldivesidylls.com.
Taj Exotica Maldives 2 images
- resort-taj-exotica-maldives-heroheroSourced from Hotelier Maldives trade-press editorial (5-article press cycle); takedown by email to editorial@maldivesidylls.com.
- resort-taj-exotica-maldives-gallery-1-emboodhu-finolhu-horseshoe-curve-overwater-villa-cluster-architectural-signature-aerialaerialSource: Same as hero (dual-bound)Hotelier Maldives trade-press editorial.
The Halcyon Private Isles 19 images
- The Halcyon Private Isles Maldives, Autograph Collection, Gaafu Alifu Atoll.heroSourced from editorial press surfaces covering the Halcyon Private Isles launch (Marriott Autograph Collection). Takedown by email to editorial@maldivesidylls.com.
- The Halcyon Private Isles Maldives sunset villa with extended infinity-edge pool, Autograph Collection, Gaafu Alifu Atoll.heroSourced from the Marriott Autograph Collection editorial press surface and travel press archives. Takedown by email to editorial@maldivesidylls.com.
- The Halcyon Private Isles Maldives sunset overwater villa pool deck with bedroom view, Autograph Collection.overwater-villaSourced from the Marriott Autograph Collection editorial press surface and travel press archives. Takedown by email to editorial@maldivesidylls.com.
- The Halcyon Private Isles Maldives sunset overwater villa pool deck with bedroom view, Autograph Collection.gallery
- The Halcyon Private Isles Maldives sunset overwater villa pool deck with bedroom view, Autograph Collection.gallery
- The Halcyon Private Isles Maldives sunset overwater villa pool deck with bedroom view, Autograph Collection.gallery
- The Halcyon Private Isles Maldives sunset overwater villa pool deck with bedroom view, Autograph Collection.gallery
- The Halcyon Private Isles Maldives sunset overwater villa pool deck with bedroom view, Autograph Collection.gallery
- The Halcyon Private Isles Maldives sunset overwater villa pool deck with bedroom view, Autograph Collection.gallery
- The Halcyon Private Isles Maldives sunset overwater villa pool deck with bedroom view, Autograph Collection.gallery
- The Halcyon Private Isles Maldives sunset overwater villa pool deck with bedroom view, Autograph Collection.gallery
- The Halcyon Private Isles Maldives sunset overwater villa pool deck with bedroom view, Autograph Collection.gallery
- The Halcyon Private Isles Maldives sunset overwater villa pool deck with bedroom view, Autograph Collection.gallery
- The Halcyon Private Isles Maldives sunset overwater villa pool deck with bedroom view, Autograph Collection.gallery
- The Halcyon Private Isles Maldives sunset overwater villa pool deck with bedroom view, Autograph Collection.gallery
- The Halcyon Private Isles Maldives sunset overwater villa pool deck with bedroom view, Autograph Collection.gallery
- The Halcyon Private Isles Maldives sunset overwater villa pool deck with bedroom view, Autograph Collection.gallery
- The Halcyon Private Isles Maldives sunset overwater villa pool deck with bedroom view, Autograph Collection.gallery
- The Halcyon Private Isles Maldives sunset overwater villa pool deck with bedroom view, Autograph Collection.gallery
The Nautilus Maldives 4 images
- resort-the-nautilus-maldives-heroheroSourced from thenautilusmaldives.com operator microsite (Naseem family ownership, independent); takedown by email to editorial@maldivesidylls.com.
- resort-the-nautilus-maldives-gallery-1-thiladhoo-feather-leaf-shape-overwater-villa-cluster-26-house-deliberately-spaced-aerial-signatureaerialSource: Same as hero (dual-bound)thenautilusmaldives.com operator microsite.
- resort-the-nautilus-maldives-gallery-4-thiladhoo-natural-island-beach-overwater-villa-aerial-setting-contextsettingthenautilusmaldives.com operator microsite.
- resort-the-nautilus-maldives-gallery-5-zeytoun-private-overwater-deck-sunset-dinner-thatched-canopy-pavilion-per-guest-shapeddiningthenautilusmaldives.com operator microsite.
The Residence Dhigurah 2 images
- resort-the-residence-dhigurah-heroheroSourced from cenizaro.com/theresidence/maldives-dg legacy CMS; takedown by email to editorial@maldivesidylls.com.
- resort-the-residence-dhigurah-gallery-1-dhigurah-long-jetty-overwater-villa-row-couple-bicycle-3-5km-island-aerial-cenizaro-signatureaerialSource: Same as hero (dual-bound)cenizaro.com legacy CMS.
The Residence Falhumaafushi 2 images
- resort-the-residence-falhumaafushi-heroheroSourced from cenizaro.com/theresidence/maldives-fm legacy CMS; takedown by email to editorial@maldivesidylls.com.
- resort-the-residence-falhumaafushi-gallery-1-falhumaafushi-twilight-overwater-villa-row-aerial-pink-purple-sunset-signature-cenizaroaerialSource: Same as hero (dual-bound)cenizaro.com legacy CMS.
The Standard Maldives 9 images
- The Standard Huruvalhi full-island drone aerial — two-row OWV configuration, circular overwater pavilion, crescent beach, pool deck.heroSourced from Hotelier Maldives trade-press editorial; takedown by email to editorial@maldivesidylls.com.
- Huruvalhi full-island aerial.aerialSource: Same as hero (dual-bound)Hotelier Maldives trade-press editorial.
- Overwater Villa cluster aerial — triple grey-shingle pyramid roofs, orange color-block accents, geometric blue-and-white plunge-pool tiles.villa-overwaterBing-bypass via neoscapesmaldives.com.
- OWV experience — couple at geometric blue-mosaic plunge pool with floating breakfast, Standard pink color-block panel.villa-overwaterSourced from Hotelier Maldives trade-press editorial.
- Todis bar interior — open-air pavilion, blue-stripe bar facade, bartender, fiddle-leaf-fig plants.diningHotelier Maldives trade-press editorial.
- Onda Mediterranean overwater pavilion aerial — orange color-block, arced OWV row, main island in background.diningSourced from Hotelier Maldives trade-press editorial.
- Onda interior — bronze disc chandelier, peaked rafter ceiling, sunken banquette dining, ocean window walls.diningSourced from Hotelier Maldives trade-press editorial.
- Overwater Spa signature aerial — triple-pavilion structure, arced orange-and-white OWV row in background.spaBing-bypass via maldives.com editorial.
- Couple walking the beach, palm-trunk frame, Standard color-block beach-villa row in the distance.lifestyleSourced from Hotelier Maldives trade-press editorial.
The Sun Siyam Iru Fushi 13 images
- Sun Siyam Iru Fushi, 221 villas on Iru Fushi island, Noonu Atoll, opened 2009 (Sun Siyam since 2014).heroSource: https://dynamic-media-cdn.tripadvisor.com/media/photo-o/1b/f4/56/f1/aerial-view.jpg?w=1500&h=-1&s=1Tripadvisor property listing editorial; takedown by email.
- resort-the-sun-siyam-iru-fushi-gallery-1-iru-fushi-infinity-water-villa-cluster-aerial-dark-tile-infinity-plunge-pool-221-villa-noonu-signatureaerial
- resort-the-sun-siyam-iru-fushi-gallery-2-water-villa-cluster-top-downaerialSun Siyam microsite; editorial takedown by email.
- resort-the-sun-siyam-iru-fushi-gallery-3-sunset-horizon-water-villa-poolvilla-overwaterSun Siyam microsite; editorial takedown by email.
- resort-the-sun-siyam-iru-fushi-gallery-4-beach-villa-porch-daybed-pavilionvilla-beachSun Siyam microsite; editorial takedown by email.
- resort-the-sun-siyam-iru-fushi-gallery-5-deluxe-beach-villa-pool-sunburstvilla-beachSun Siyam microsite; editorial takedown by email.
- resort-the-sun-siyam-iru-fushi-gallery-6-family-beach-villa-domed-ceiling-interiorvilla-beachSun Siyam microsite; editorial takedown by email.
- resort-the-sun-siyam-iru-fushi-gallery-7-trio-italian-prawn-tortellonidiningSun Siyam microsite; editorial takedown by email.
- resort-the-sun-siyam-iru-fushi-gallery-8-taste-of-india-beachfront-deckdiningSun Siyam microsite; editorial takedown by email.
- resort-the-sun-siyam-iru-fushi-gallery-9-bamboo-asian-pavilion-pendantsdiningSun Siyam microsite; editorial takedown by email.
- resort-the-sun-siyam-iru-fushi-gallery-10-flavours-french-cathedral-ceilingdiningSun Siyam microsite; editorial takedown by email.
- resort-the-sun-siyam-iru-fushi-gallery-11-islanders-grill-beach-tablesdiningSource: https://www.sunsiyam.com/media/34ih0tt3/sunsiyam_irufushi_islanders-grill-exterior-_2038.jpgSun Siyam microsite; editorial takedown by email.
- resort-the-sun-siyam-iru-fushi-gallery-12-spa-overwater-massagespaSun Siyam microsite; editorial takedown by email.
The Westin Maldives Miriandhoo 2 images
- resort-the-westin-maldives-miriandhoo-heroheroSourced via Bing-bypass / cache.marriott.com property CDN; takedown by email to editorial@maldivesidylls.com.
- resort-the-westin-maldives-miriandhoo-gallery-1-miriandhoo-teardrop-crescent-overwater-villa-row-double-bend-baa-atoll-aerial-signatureaerialSource: Same as hero (dual-bound)Marriott property CDN via Bing-bypass.
Vakarufalhi Island Resort 4 images
- resort-vakarufalhi-island-resort-heroheroSourced via Bing-bypass / koamastravel.com editorial; takedown by email to editorial@maldivesidylls.com.
- resort-vakarufalhi-island-resort-gallery-1-vakarufalhi-full-island-aerial-curved-overwater-villa-row-arrival-jetty-reef-bound-house-reefaerialSource: Same as hero (dual-bound)Bing-bypass via koamastravel.com.
- resort-vakarufalhi-island-resort-gallery-4-vakarufalhi-reef-bound-oval-circular-lagoon-breakwater-perimeter-house-reef-aerial-signaturesettingBing-bypass via malediven.deals editorial.
- resort-vakarufalhi-island-resort-gallery-7-vakarufalhi-overwater-spa-three-thatched-pyramid-pavilion-stilted-walkway-signaturespaBing-bypass via koamastravel.com editorial.
Vakkaru Maldives 3 images
- resort-vakkaru-maldives-heroheroSourced from vakkarumaldives.com operator microsite (open path-based asset delivery); takedown by email to editorial@maldivesidylls.com.
- resort-vakkaru-maldives-gallery-1-vakkaru-birds-eye-banner-island-curving-sandbank-sailboat-couple-overwater-row-reef-edge-baa-atollaerialSource: Same as hero (dual-bound)vakkarumaldives.com operator microsite.
- resort-vakkaru-maldives-gallery-2-vakkaru-overwater-villa-cluster-curved-walkway-twin-plunge-pool-platform-property-signature-architecturevilla-overwatervakkarumaldives.com operator microsite.
Varu By Atmosphere 2 images
- resort-varu-by-atmosphere-heroheroSourced via Bing-bypass / familytravelgenie.com editorial; takedown by email to editorial@maldivesidylls.com.
- resort-varu-by-atmosphere-gallery-1-varu-madivaru-multi-arm-reef-bound-island-overwater-villa-row-jetty-house-reef-breakline-aerial-signatureaerialSource: Same as hero (dual-bound)Bing-bypass via familytravelgenie.com.
Velaa Private Island 11 images
- Velaa Private Island, Noonu Atoll, sunset on the boat transfer.heroSourced from the official Velaa Private Island press image library (framerusercontent.com) for editorial review. Takedown by email to editorial@maldivesidylls.com.
- Velaa Private Island beach with beachfront pavilion in palms.settingSourced from theluxurytravelexpert.com personal stay review (May 2022) for editorial reference. Takedown by email to editorial@maldivesidylls.com.
- Athiri all-day open-air dining pavilion at Velaa Private Island.diningSourced from theluxurytravelexpert.com personal stay review (May 2022) for editorial reference. Takedown by email to editorial@maldivesidylls.com.
- Velaa Academy nine-hole pitch-and-putt driving range on a separate Noonu islet.activitiesSourced from theluxurytravelexpert.com personal stay review (May 2022) for editorial reference. Takedown by email to editorial@maldivesidylls.com.
- Velaa overwater spa pavilions reached by curved timber boardwalk from the beach.spaSourced from theluxurytravelexpert.com personal stay review (May 2022) for editorial reference. Takedown by email to editorial@maldivesidylls.com.
- Arrival on the Velaa boardwalk, dried palm-trunk planters flanking the path, electric cart standing by.lifestyleSourced from the official Velaa Private Island press image library (framerusercontent.com) for editorial review. Takedown by email to editorial@maldivesidylls.com.
- Beach Pool Villa bedroom at Velaa Private Island, vaulted timber roof, hanging chair, glass walls to private pool and garden.villa-beachSourced from the official Velaa Private Island press image library (framerusercontent.com) for editorial review. Takedown by email to editorial@maldivesidylls.com.
- Beach Pool Villa bedroom at Velaa Private Island, daybed alcove with orange and teal cushions, glass doors to private pool and beach.villa-beachSourced from the official Velaa Private Island press image library (framerusercontent.com) for editorial review. Takedown by email to editorial@maldivesidylls.com.
- Aerial of Velaa overwater villa cluster, thatched-roof bungalow with cantilevered pool deck over turquoise lagoon.villa-overwaterSourced from the official Velaa Private Island press image library (framerusercontent.com) for editorial review. Takedown by email to editorial@maldivesidylls.com.
- Aerial of a single Velaa overwater pool villa with cantilevered pool over the lagoon's coral edge.villa-overwaterSourced from the official Velaa Private Island press image library (framerusercontent.com) for editorial review. Takedown by email to editorial@maldivesidylls.com.
- Romantic Pool Residence living room at Velaa, double-height vaulted ceiling with green-leaf installation, chandelier, turtle photo art, teal patchwork rug.villa-residenceSourced from the official Velaa Private Island press image library (framerusercontent.com) for editorial review. Takedown by email to editorial@maldivesidylls.com.
Velassaru Maldives 15 images
- Velassaru Maldives drone aerial of the South Malé Atoll private island.heroSource: https://universalresorts.com/wp-content/uploads/2023/10/Vela-18-AUG-Drone-Arrival-60-new-Sky.jpgSourced from the official Velassaru / Universal Resorts press image library for editorial review. Takedown by email to editorial@maldivesidylls.com.
- Velassaru Maldives drone aerial of the South Malé Atoll private island.heroSource: https://universalresorts.com/wp-content/uploads/2023/10/Vela-18-AUG-Drone-Arrival-60-new-Sky.jpgSourced from the official Velassaru / Universal Resorts press image library for editorial review. Takedown by email to editorial@maldivesidylls.com.
- Velassaru Maldives water villas row at the over-water configuration: thatch-roof villas on stilts with white parasols on each deck, sun loungers, vivid turquoise lagoon, South Male Atoll.gallery
- Velassaru Maldives water villas row at the over-water configuration: thatch-roof villas on stilts with white parasols on each deck, sun loungers, vivid turquoise lagoon, South Male Atoll.gallery
- Velassaru Maldives water villas row at the over-water configuration: thatch-roof villas on stilts with white parasols on each deck, sun loungers, vivid turquoise lagoon, South Male Atoll.gallery
- Velassaru Maldives water villas row at the over-water configuration: thatch-roof villas on stilts with white parasols on each deck, sun loungers, vivid turquoise lagoon, South Male Atoll.gallery
- Velassaru Maldives water villas row at the over-water configuration: thatch-roof villas on stilts with white parasols on each deck, sun loungers, vivid turquoise lagoon, South Male Atoll.gallery
- Velassaru Maldives water villas row at the over-water configuration: thatch-roof villas on stilts with white parasols on each deck, sun loungers, vivid turquoise lagoon, South Male Atoll.gallery
- Velassaru Maldives water villas row at the over-water configuration: thatch-roof villas on stilts with white parasols on each deck, sun loungers, vivid turquoise lagoon, South Male Atoll.gallery
- Velassaru Maldives water villas row at the over-water configuration: thatch-roof villas on stilts with white parasols on each deck, sun loungers, vivid turquoise lagoon, South Male Atoll.gallery
- Velassaru Maldives water villas row at the over-water configuration: thatch-roof villas on stilts with white parasols on each deck, sun loungers, vivid turquoise lagoon, South Male Atoll.gallery
- Velassaru Maldives water villas row at the over-water configuration: thatch-roof villas on stilts with white parasols on each deck, sun loungers, vivid turquoise lagoon, South Male Atoll.gallery
- Velassaru Maldives water villas row at the over-water configuration: thatch-roof villas on stilts with white parasols on each deck, sun loungers, vivid turquoise lagoon, South Male Atoll.gallery
- Velassaru Maldives water villas row at the over-water configuration: thatch-roof villas on stilts with white parasols on each deck, sun loungers, vivid turquoise lagoon, South Male Atoll.gallery
- Velassaru Maldives water villas row at the over-water configuration: thatch-roof villas on stilts with white parasols on each deck, sun loungers, vivid turquoise lagoon, South Male Atoll.gallery
Veligandu Island Resort 11 images
- Veligandu Island aerial.heroveligandu.com operator microsite.
- Veligandu sandbank-extension aerial.aerialSource: Same as hero (dual-bound)veligandu.com operator microsite.
- Teardrop woven-rattan beach pod with model in pink dress.settingSourced via koamastravel.com editorial.
- Jacuzzi Beach Villa thatched deck with turquoise loungers.villa-beachSourced via koamastravel.com editorial.
- Sunset Jacuzzi Water Villa deck with turquoise loungers.villa-overwaterSourced via koamastravel.com editorial.
- Dhonveli buffet with couple, carved fruit and demon-mask display.diningSourced via koamastravel.com editorial.
- Himeyn Spa couples treatment room — coconut scrub setup.spaOperator microsite.
- Madivaru hammerhead shark point dawn dive.activitiesOperator microsite.
- Thundi Bar with couple in red Egg chairs.diningSourced via koamastravel.com editorial.
- Romantic beach dining at twilight, couple, rose petals.diningSourced via koamastravel.com editorial.
- Topcat catamaran with red-and-white sail.activitiesSourced via koamastravel.com editorial.
Vilamendhoo Island Resort 4 images
- resort-vilamendhoo-island-resort-heroheroSourced via Bing-bypass / medias.exotismes.fr editorial; takedown by email to editorial@maldivesidylls.com.
- resort-vilamendhoo-island-resort-gallery-1-vilamendhoo-elongated-island-aerial-water-villa-row-sandbar-tail-reef-edge-transitions-south-ariaerialSource: Same as hero (dual-bound)Bing-bypass via medias.exotismes.fr.
- resort-vilamendhoo-island-resort-gallery-4-vilamendhoo-house-reef-from-shore-aerial-snorkel-depth-coral-patches-visible-signaturesettingSourced from vilamendhoo.com operator microsite (Crown & Champa Resorts CloudFront WP-uploads with Referer header bypass).
- resort-vilamendhoo-island-resort-gallery-6-vilamendhoo-overwater-restaurant-long-timber-deck-white-linen-tables-jetty-pavilion-overwater-specialitydiningBing-bypass via media.oovatu.com editorial.
Vilu Reef Resort 3 images
- resort-vilu-reef-resort-heroheroSourced from sunsiyam.com operator microsite (Sun Siyam Resorts; Umbraco CMS /media/ asset path); takedown by email to editorial@maldivesidylls.com.
- resort-vilu-reef-resort-gallery-1-vilu-reef-meedhuffushi-island-palm-canopy-reef-edge-deep-ocean-aerial-dhaalu-southernaerialSource: Same as hero (dual-bound)sunsiyam.com operator microsite.
- resort-vilu-reef-resort-gallery-3-vilu-reef-water-villa-row-thatched-roof-overwater-foliage-framed-editorial-compositionvilla-overwatersunsiyam.com operator microsite.
W Maldives 5 images
- resort-w-maldives-heroheroSourced via Bing-bypass / cache.marriott.com property CDN; takedown by email to editorial@maldivesidylls.com.
- resort-w-maldives-gallery-1-fesdu-round-island-full-aerial-overwater-oasis-cluster-wet-deck-tent-cabanas-marriott-cdn-signatureaerialSource: Same as hero (dual-bound)Marriott property CDN via Bing-bypass.
- resort-w-maldives-gallery-2-overwater-oasis-villa-cluster-topdown-organic-central-plaza-spider-leg-boardwalk-w-brand-bold-designvilla-overwaterMarriott property CDN via Bing-bypass.
- resort-w-maldives-gallery-4-fesdu-house-reef-turtle-away-spa-tent-pavilions-split-level-overwater-central-ari-settingsettingSource: https://hoteliermaldives.com/wp-content/uploads/2026/03/batch_W-Maldives-House-Reef-Away-Spa.jpgSourced from Hotelier Maldives trade-press editorial; takedown by email to editorial@maldivesidylls.com.
- resort-w-maldives-gallery-7-away-spa-tent-sail-roof-pavilions-aerial-chain-luxury-w-brand-wellness-property-signaturespaMarriott property CDN via Bing-bypass.
Waldorf Astoria Ithaafushi 1 images
You And Me Cocoon Maldives 10 images
- Twilight aerial of You & Me Maldives — full property geometry, pool deck pavilion, overwater villa row with warm interior lights.heroSourced from youandmemaldives.com operator microsite (Wix CDN); takedown by email to editorial@maldivesidylls.com.
- Twilight property aerial.aerialSource: Same as hero (dual-bound)youandmemaldives.com operator microsite (Wix CDN).
- Aqua Suite with Slide row aerial — blue waterslides projecting from each villa deck into lagoon.villa-overwateryouandmemaldives.com operator microsite (Wix CDN).
- Lagoon Villa interior — handcrafted driftwood bed, exposed rafters, flying-koi-fish artwork, retractable ocean doors.villa-beachyouandmemaldives.com operator microsite (Wix CDN).
- H2O underwater restaurant aisle perspective — acrylic-tube architecture, model walking down aisle, set tables, arched entryway.diningyouandmemaldives.com operator microsite (Wix CDN).
- La Pasta Italian close-up — grilled bruschetta with tomato and basil, gingham tablecloth, garden light.diningyouandmemaldives.com operator microsite (Wix CDN).
- Lagoon Suite with Pool top-down aerial — couple at plunge pool, second guest swimming in lagoon.villa-overwateryouandmemaldives.com operator microsite (Wix CDN).
- Painted-tree beach ceremony installation — pink-and-turquoise log stools, painted tree-branch sculptures, OWV row in distance.settingyouandmemaldives.com operator microsite (Wix CDN).
- H2O underwater restaurant table view — arched window framing reef sharks and fish, set table with tablecloth and wine.diningyouandmemaldives.com operator microsite (Wix CDN).
- Beach private dining at sunset — couple at white-linen table, paper-lantern candle ring, OWV row in distance.diningyouandmemaldives.com operator microsite (Wix CDN).
Alif Dhaal 2 images
- Hangnaameedhoo, an island in South Ari Atoll, the whale-shark route.heroCC BY-SA 4.0 via Wikimedia Commons; author: Ximpepe.
- Hangnaameedhoo, an island in South Ari Atoll, the whale-shark route.heroCC BY-SA 4.0 via Wikimedia Commons; author: Ximpepe.
Baa Atoll 1 images
- Baa Atoll lagoon, the UNESCO Biosphere Reserve in the central Maldives.heroCC BY-SA 4.0 via Wikimedia Commons; author: Ahmed Abdul Rahman.
Laamu 1 images
- Olhuveli Island, Hithadhoo-Laamu Atoll.heroCC BY 3.0 via Wikimedia Commons; author: jfdebon (Panoramio).
Noonu 1 images
- Noonu Atoll aerial, Soneva Jani wellness island.heroSourced from Soneva.com official communications (Soneva Jani property in Noonu Atoll) for editorial review. Takedown by email to editorial@maldivesidylls.com.
North Male 2 images
- Guriadhoo aerial view, North Malé Atoll, 2019.heroCC BY-SA 4.0 via Wikimedia Commons; author: Luka Peternel.
- Guriadhoo aerial view, North Malé Atoll, 2019.heroCC BY-SA 4.0 via Wikimedia Commons; author: Luka Peternel.
Seenu 2 images
- Addu Atoll beach, far south Maldives.heroCC BY 2.0 via Wikimedia Commons; author: David Stanley.
- Addu Atoll beach, far south Maldives.heroCC BY 2.0 via Wikimedia Commons; author: David Stanley.